KEGG   Kosakonia cowanii: BWI95_05815Help
Entry
BWI95_05815       CDS       T04691                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kco  Kosakonia cowanii
Pathway
kco00071  Fatty acid degradation
kco00280  Valine, leucine and isoleucine degradation
kco00310  Lysine degradation
kco00362  Benzoate degradation
kco00380  Tryptophan metabolism
kco00620  Pyruvate metabolism
kco00630  Glyoxylate and dicarboxylate metabolism
kco00640  Propanoate metabolism
kco00650  Butanoate metabolism
kco00900  Terpenoid backbone biosynthesis
kco01100  Metabolic pathways
kco01110  Biosynthesis of secondary metabolites
kco01120  Microbial metabolism in diverse environments
kco01130  Biosynthesis of antibiotics
kco01200  Carbon metabolism
kco01212  Fatty acid metabolism
kco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWI95_05815
   00630 Glyoxylate and dicarboxylate metabolism
    BWI95_05815
   00640 Propanoate metabolism
    BWI95_05815
   00650 Butanoate metabolism
    BWI95_05815
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BWI95_05815
   00072 Synthesis and degradation of ketone bodies
    BWI95_05815
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWI95_05815
   00310 Lysine degradation
    BWI95_05815
   00380 Tryptophan metabolism
    BWI95_05815
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BWI95_05815
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BWI95_05815
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BWI95_05815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kco04147]
    BWI95_05815
Enzymes [BR:kco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BWI95_05815
Exosome [BR:kco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BWI95_05815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: APZ04605
UniProt: A0A1U7DZI3
Position
complement(1243102..1244283)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAVRTPIGCFQGALSRHSAVELGSAVVQALLARSGVQPQDIDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLASQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRERQDEWAL
SSQHKARMAIDSGRFRDEIVPVQTQSADGKRVLVDTDEQPRTDASAEALAQLSPAFETSG
SVTAGNASPINDGAAAVLMMSAERAEALNLPVLARIRAFASVGVDPALMGIAPVYAMRRC
LERAGWQLDDVDLIEANEAYAAQALSVGKILEWDEKRVNVNGGAIALGHPIGASGCRILV
SLVHEMQKRKARKGLATLCIGGGQGVALAIERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtgattgtcggcgccgtgcgcacgccaatcggctgttttcagggggcg
ctgtcgcgtcactctgccgttgagctgggcagcgcggtggtgcaggcgttactggcgcgc
agcggcgtgcagccgcaggatatcgatgaggtgattctgggccaggtgctgaccgccggg
gccgggcagaacccggcgcgccagtcggcgatcaagggtgggctgccaaatacggtttcc
gcgatcaccatcaacgatgtgtgcggctccgggctgaaagcgctgcatctcgcctcgcag
gcgatccagtgcggcgaagccgacgtggtgattgccggcggccaggagaacatgagccgc
gcgccgcatgtattaaccgatagccgcaccggggcgcagcttggtaacagccagcttatc
gacagcctggtgcatgacgggttatgggatgcgtttaatgattaccatatgggcgtcacg
gcggagaacctggcgcgggaatatggcatcagccgcgagcgccaggatgagtgggcgctc
agttcgcaacataaagcgcggatggctatcgactccggtcgttttcgcgacgagattgtt
cctgtgcagactcagagcgccgacggcaagcgtgtgctggtcgataccgatgagcagccg
cgcaccgatgccagtgctgaagcgctggcgcagctcagcccggcttttgaaaccagcggc
tcggtgactgccggtaacgcatcgcctattaatgatggcgcggcggcggtgctgatgatg
agcgcggaacgcgcagaggcgctcaacttaccggtactggcgcgtattcgtgcctttgca
agcgtgggcgtcgatccggcgctgatgggcattgcgccggtttacgccatgcggcgttgc
cttgagcgcgctggctggcagctggatgatgtcgacctgattgaagccaatgaggcttat
gccgcgcaggcgctatcggtggggaaaatccttgagtgggatgagaagcgcgtcaacgtc
aatggcggcgcgattgcgctcggccatccgattggcgcctccggctgtcgcatcctggtg
tcgctggtgcatgagatgcaaaagcgtaaggcgcgcaaaggactggcaacactctgtatt
ggtggtggccagggcgtcgcgctggccatcgagcgtgactaa

DBGET integrated database retrieval system