KEGG   Kosakonia cowanii: BWI95_17395Help
Entry
BWI95_17395       CDS       T04691                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
kco  Kosakonia cowanii
Pathway
kco00740  Riboflavin metabolism
kco00790  Folate biosynthesis
kco01100  Metabolic pathways
kco01110  Biosynthesis of secondary metabolites
kco02024  Quorum sensing
Module
kco_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BWI95_17395
   00790 Folate biosynthesis
    BWI95_17395
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BWI95_17395
Enzymes [BR:kco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BWI95_17395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: APZ06691
Position
3678334..3678921
Genome map
AA seq 195 aa AA seqDB search
MQLKRVAEAKLPTPWGDFLMVGFEELATGQDHVALVYGDISGQLPVLARVHSECLTGDAL
FSLRCDCGFQLEAALNHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLAVDEVRLLTNNPKKVEILTEAGINIVERVPLIVGRNPKNE
HYLDTKAEKMGHLLK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaaacgtgtggcagaagccaaactgccaaccccatggggcgacttcctgatg
gtgggttttgaagaactggcaaccggacaggatcatgtggccctggtgtatggtgatatt
tccgggcagttgcccgttctcgcacgtgtgcactccgagtgtttaaccggcgatgcgttg
ttcagcctgcgctgcgactgcggcttccagcttgaagcggcgctgaatcacattgctgaa
gagggccgcggtgtcctgctctatcatcgtcaggagggccgtaacatcggcttgctgaat
aagatccgcgcctatgcgctgcaggatcagggctatgacaccgtcgaagccaaccaccag
cttggctttgccgccgacgagcgtgacttcaccctctgcgctgatatgttcaaattgctg
gcggtggatgaggtacgtctgctgaccaataacccgaagaaagtggagatcctgaccgaa
gccgggatcaatattgtcgagcgcgtgccgctgattgtgggacgcaatccgaagaatgag
cactatctcgatacgaaagcggaaaagatgggacatctgctgaagtag

DBGET integrated database retrieval system