KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0517
Entry
Kcr_0517          CDS       T00668                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K23121  trans-4-hydroxy-L-proline dehydratase [EC:4.2.1.172]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00330  Arginine and proline metabolism
kcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kcr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Kcr_0517
Enzymes [BR:kcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.172  trans-4-hydroxy-L-proline dehydratase
     Kcr_0517
SSDB
Motif
Pfam: PFL-like Gly_radical TelA
Other DBs
NCBI-ProteinID: ACB07270
UniProt: B1L491
Position
527271..529724
AA seq 817 aa
MTLTTPEASCEVKISKEVEKRRSVIRPINERIARLREESVNAQVKVSLERAKLITEFYKS
DIPKGKSIPVQRALAFKYLMERVSLPIEEGQLIVGLRGTGVKEVPTYPEICVHSLEDLEI
LDKRKNMPYKVDEETKEFYEREAIPFWRGRAMRDIIFESLPEEWIDAYEAGVWTEFMEQR
APGHTAGGERIFRMGVLDIKEQIRRKMESLDPSDPEYYEKMEELKAMDIVADAIMIYARR
YAEKLEQMAKEEKDPERKKELEQMAEICRWVPAHAPRTFWEALQHYWFVHVGVTYETNPW
DSFNPGRIDQHLYPFYKRDIEEGRLTRERAKELLQAFWLKFNNQPAVPKVGVTAEESFTY
NDFSKLNLGGLTKDGKDGVNELSYLILEVLDEMRTLQPNTAVLISEKNPDSFLIKALKVV
GPGFGEPPFFNFDGVIVKMLRQGKSLEDARTSGVSGCVESGSFGKECYILTGYFNLPKIL
EITLNNGVDPRTGKKIGLETGDPREFKSFEDLWNAFIKQVKYFLDIKMKGNDIIEALYAK
YLPVPFLSLWIDDCVEKAKDYNAGGARYNTQYIQVVGLGTITDSLAAIKYHVFEKGTVSM
SELLDALSKNFEGYEFLREILRNPDKTPKFGNDDDYADSIAKEVVDRIVELIESYPRSPV
RKASRRAYFLPTTVHVYFGKVTGATPDGRVAGFPVSEGISPVQGMDRRGIAAVFRSVAKC
DWDKTGGALLNQKLTPDIFDNEENLRKLAQLIRAFFRLGGHHVQFNVVSAELLREAQRRP
QDFQDLMVRVAGYSDYFVNLPKGLQDEIIERTEHKSL
NT seq 2454 nt   +upstreamnt  +downstreamnt
atgactctcactacccccgaagcctcttgcgaggtcaagatttcgaaggaagttgagaaa
aggaggagtgtaattaggccgataaatgagaggatcgctaggttgagggaggagagtgtt
aacgctcaagttaaggtatccctagagagggctaaattaatcaccgaattttacaagagc
gatatcccgaaggggaaatcgatccccgtgcagagggctctcgcgttcaagtaccttatg
gagagagtcagcctccccatcgaggagggccagctaatagttggcctcagggggactgga
gttaaggaagtcccgacttaccctgagatatgcgtccacagcctcgaggatctcgagatc
ctcgataagaggaagaacatgccctacaaggtagatgaggagaccaaggagttctatgag
agggaagcgatacccttctggagaggcagggccatgagggacattatattcgagagctta
cccgaggagtggatagatgcctatgaggcaggagtttggactgagttcatggagcagagg
gctcccgggcacactgctggcggagagaggatattcaggatgggagtcctggacataaag
gagcagataaggaggaagatggaatccttagatccctcggatcccgagtactacgagaag
atggaggagctcaaggccatggatatagtggctgatgccataatgatatacgctaggagg
tacgctgagaaattggagcagatggctaaggaggagaaggatcctgagaggaagaaagag
ttagagcagatggctgaaatatgcagatgggtaccagctcatgctcccagaaccttctgg
gaagctcttcagcattactggttcgttcatgtgggcgttacttatgagacgaacccctgg
gactctttcaacccggggaggatagatcagcacctctatccattctacaagagggatata
gaggagggaaggctaactagggagagggccaaggagctattgcaagcgttctggctcaag
ttcaacaatcagccagctgtcccaaaggtgggggtcacagctgaggagagcttcacctac
aacgacttctccaagcttaacttgggaggcctgacgaaggacgggaaggacggtgtcaat
gaactctcctacttaatattggaggtcctggatgagatgaggacactccagcccaatact
gcggttctgatcagtgagaaaaatccagatagcttcttaataaaggccctcaaggtagta
ggccctggattcggtgagccccccttcttcaatttcgacggagttatagtgaagatgctg
aggcaggggaagagcctggaggatgccaggacctctggagtgagtggatgcgttgaatct
ggctccttcgggaaggagtgctacatactgacgggttacttcaacctgcccaagatactg
gagataactctcaataatggagtggacccgaggaccgggaagaagataggccttgagaca
ggggatccgagggagttcaagagctttgaggacctttggaatgctttcatcaagcaggtg
aagtacttcttggacataaagatgaaggggaatgatataatcgaagctctatacgctaag
tacctcccagtcccgttcctctccctctggatagatgattgcgtcgagaaggcgaaggat
tacaacgccggaggagctaggtacaacactcagtacatccaagtggtcggattgggtact
ataactgacagcttagctgccataaagtaccatgtattcgagaagggaaccgtatcgatg
tcggagctcttggatgcgctctcaaagaacttcgagggatatgagttcctcagggagata
ctgagaaatccggataagacgcccaaattcgggaacgatgatgattacgctgactccata
gctaaggaagtagtcgataggattgtggagcttatagagagctatccgaggagccccgtg
aggaaggcatcgagaagagcgtacttcctgcccacgacagtccacgtctacttcgggaag
gtgactggagcgacgcctgatggcagagttgcgggattcccagtatctgaaggtatatct
ccagtgcaaggcatggataggaggggcatagcagccgtcttcaggagcgtcgctaagtgc
gattgggacaagactggaggggccctcctgaaccagaaactcacgcctgatatatttgat
aatgaggagaatttgaggaagctagctcaactcatcagagcgttcttcaggctcggtggc
catcacgtgcagttcaatgtcgtcagcgctgagctcctgagggaagctcagaggaggcct
caggacttccaggacctcatggtcagggtagccggttacagcgactacttcgtcaactta
ccgaaggggctccaggatgagataatagagaggaccgagcacaaatccctctga

DBGET integrated database retrieval system