KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0175Help
Entry
Kcr_0175          CDS       T00668                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00260  Glycine, serine and threonine metabolism
kcr00680  Methane metabolism
kcr01100  Metabolic pathways
kcr01120  Microbial metabolism in diverse environments
kcr01130  Biosynthesis of antibiotics
kcr01200  Carbon metabolism
kcr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kcr00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Kcr_0175
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kcr_0175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kcr04147]
    Kcr_0175
Enzymes [BR:kcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Kcr_0175
    1.1.1.399  2-oxoglutarate reductase
     Kcr_0175
Exosome [BR:kcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kcr_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AlaDh_PNT_C THF_DHG_CYH_C AdoHcyase_NAD HEM4
Motif
Other DBs
NCBI-ProteinID: ACB06935
UniProt: B1L3A6
Position
complement(176228..177133)
Genome map
AA seq 301 aa AA seqDB search
MADNIPKDLDRELEPYGEVSRDWNRLEDATVLIIRTDRKLDADDFSRAPMLKLIITATHG
LDHIDIEEAKRRAVIVERAPVRARAVAELALGIILALARGIAYSDRKMRGLEWVKGRVRG
FELAGRRVGVISMGIVGREVAEVLKGIGMHVDYYDRYRTGGRSLERLLRESDIVVLTSPL
TEETRGLIGRREIAMMKDGAILVNVGRGELLDLDVALEALETGKLGGLGLDVYPREPPFG
DEAFERLRNMDNVILTPHLGGSSEEAERRIVSEVLGIMGKWFGRRSEISRDISALGSLNP
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggctgataacattcctaaggacttagatagggagctagagccttacggagaagttagc
agggattggaacaggcttgaggatgccactgtcctcataatcaggaccgataggaaatta
gatgcagatgatttctctagagcgcctatgctcaagctgatcataactgcgacgcatggc
ctcgatcatatagacattgaggaagctaagaggagagcagtaatagttgagagagctcct
gttagggctagagctgtagctgagctcgctctgggcatcatactagctttagctaggggg
atagcttactcagataggaagatgagggggctggagtgggttaaggggagagtgagggga
ttcgagctcgctggaaggagggttggggttatatccatgggtatagttggcagagaggtt
gctgaagtgctaaaggggatagggatgcacgtagattactatgacaggtataggacggga
ggaaggagcttggagaggttactcagggagagcgatatcgtagtactgacatcccccctc
actgaggagactaggggcttgataggcaggagggagatagctatgatgaaggacggagct
atattagtcaacgtcggcaggggggagctgctggacttagatgtcgccttagaagctcta
gaaaccggtaaactcggagggctaggtttggacgtatatcctagggagcctcccttcggg
gatgaggctttcgagaggttgaggaatatggataacgtcatcctcacacctcacttggga
gggagcagtgaggaagctgagaggaggatagtatctgaagtattggggataatgggcaag
tggttcgggaggagatccgagatcagtagggatattagtgccttaggatcccttaatcct
atctga

DBGET integrated database retrieval system