KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0198Help
Entry
Kcr_0198          CDS       T00668                                 

Definition
(GenBank) Acyl-CoA synthetase (NDP forming)
  KO
K01905  acetate---CoA ligase (ADP-forming) subunit alpha [EC:6.2.1.13]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00010  Glycolysis / Gluconeogenesis
kcr00620  Pyruvate metabolism
kcr00640  Propanoate metabolism
kcr01100  Metabolic pathways
kcr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kcr_0198
   00620 Pyruvate metabolism
    Kcr_0198
   00640 Propanoate metabolism
    Kcr_0198
Enzymes [BR:kcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Kcr_0198
Lipid biosynthesis proteins [BR:kcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Kcr_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Succ_CoA_lig CoA_binding_2 CoA_binding
Motif
Other DBs
NCBI-ProteinID: ACB06958
UniProt: B1L3C9
Structure
PDB: 

Position
complement(197973..199367)
Genome map
AA seq 464 aa AA seqDB search
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPK
VSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHS
YGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISS
IVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIK
AGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGER
LIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDW
YYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVA
EAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctagagaggctattcaacccatcagctatagccgtagtcggggcatcgaag
gaccccagcaagatagggtcccagattttaaggaatctcctgagctatggattcaagggg
aaggtctatccgataaacccaactgcagatgagttgatggggctcaaatgctaccctaag
gtatctgacgtgcctgataaagtcgatgtagctgtgatatccgtaccctccgataaagta
ctgggagtaatagatgactgcggtaaggccggagttaagttcgctgtcgtgataacttca
gggttcaaggaggtggggaatgaggagttggaggaggagctggtgaggagggctcacagc
tatgggatgagagtacttggacccaacatattcggctacctctacgctccagctaggctc
aacgctaccttcggacctaaagatgtgctctcagggaatgtagcttttatctcgcagagc
ggggcactggggatagctttgatggggtatacggtagttgagaacatagggatctcatcc
atagtgagtgtgggtaataaggcggatctggacgatgtggatctcctcgatttcttcgat
aaggatccgaacaccggtgttataatgatatacttggaggggatagcccccggcaggggg
aggatgttcatagatgtcgcctcaagggtgagcttgaggaagcccataatcgtgataaag
gccggcaggaccgaggtaggcgccagagctgctgcaagccatacgggatcgattgcaggg
agcgtagctatttatgagagcgctttcaagcagagcgggattctgatggctaaaagtgtt
gaagacgctttcgattggacgaaagcgctctcatggaacccaatcccggagggagagagg
ctcatcgtcctaactaatggaggaggggccggtgtccaatcgactgatactttcgccgat
aatggaatttacctcagcaagcctccagagagcttaattcaggagataaagaaattcgtc
ccgcccttcgcttccttcgcgaatccgatagatattacggggatggctccggatgattgg
tattacatgggaaccctagctgccctcaagaaccctgatgtagatgccctgaccgtctta
tattgtcagaccgcagtaacgacacctataggggtcgctaaggggatagtggacgctata
aaggaagctgggaacagcaaaccagtgacagtgggaatggtcgggggccccgaggtagct
gaagctgttagcttccttaacaagcagaggatagctgcctaccccaccccggagagggct
tcctcagctatgtcagctctttacgcatacgctagggccaggagctacgtgatgaagagc
ctggccgtgaggtga

DBGET integrated database retrieval system