KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0848Help
Entry
Kcr_0848          CDS       T00668                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00521  Streptomycin biosynthesis
kcr00523  Polyketide sugar unit biosynthesis
kcr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Kcr_0848
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Kcr_0848
Enzymes [BR:kcr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Kcr_0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_1 Cupin_2
Motif
Other DBs
NCBI-ProteinID: ACB07594
UniProt: B1L565
Position
854552..855094
Genome map
AA seq 180 aa AA seqDB search
MPFKSFKRLEIPDLLLIDHVLFPDSRGFFTELYKKSDFTGNGIPHDFVQVNLSYSRKGVV
RGLHYQLKPMEQGKLVYVISGKVFDVAVDIRRGSKWFGRYVSVLLEPGLALWIPPGFAHG
FQALEDTYFLYLVTKEYSPQHERCIKWDDQEIGIEWPLKEAVLSERDSKCPPLKSCETNF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcaagagttttaagagactcgagataccagatttattattaatagatcatgtt
ttatttcccgattcgagaggtttctttacagagctttacaagaaatcggatttcacaggg
aatggcatcccgcacgacttcgtccaagtgaacttgagctattcgaggaagggcgtagtt
agggggcttcactatcaactgaagccgatggaacaagggaagttagtatacgttataagt
ggtaaagtttttgacgttgcagtcgatattagaaggggttcaaaatggtttggaaggtat
gttagtgtattgctcgagcccggcctcgctctctggataccacctggattcgcgcacggt
ttccaagccctagaggatacgtacttcctctacctcgtgacgaaggagtactcacctcag
catgagagatgtattaaatgggatgatcaggagatagggatcgagtggcctctgaaggag
gctgtattgagtgagagggactctaaatgcccgcctctcaaatcatgcgagacgaatttt
tga

DBGET integrated database retrieval system