KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1137Help
Entry
Kcr_1137          CDS       T00668                                 

Definition
(GenBank) Histones H3 and H4
Organism
kcr  Candidatus Korarchaeum cryptofilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBFD_NFYB_HMF Histone Bromo_TP CENP-T_C TFIID-31kDa TFIID_20kDa CENP-S TAF TFIID-18kDa CENP-X
Motif
Other DBs
NCBI-ProteinID: ACB07883
UniProt: B1L604
Position
1145322..1145546
Genome map
AA seq 74 aa AA seqDB search
MPRVRYLPLAPIGRIIRDAGAERVSDAAVEALERYMEKFALEVGRQAVSLAKHANRKTVS
GEDIDLAIKTVWKA
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgccaagggttaggtatctgcctctcgctcccattgggaggataataagagacgctggt
gcggagagggtaagtgacgcagccgttgaggcattagagcgctatatggagaagtttgcg
ctcgaagtgggcaggcaggctgtcagtctggccaaacacgcgaacaggaagactgtatcc
ggtgaggatatagatctcgcgataaagaccgtttggaaggcttga

DBGET integrated database retrieval system