KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1229Help
Entry
Kcr_1229          CDS       T00668                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr00010  Glycolysis / Gluconeogenesis
kcr00020  Citrate cycle (TCA cycle)
kcr00620  Pyruvate metabolism
kcr00633  Nitrotoluene degradation
kcr00640  Propanoate metabolism
kcr00650  Butanoate metabolism
kcr00680  Methane metabolism
kcr00720  Carbon fixation pathways in prokaryotes
kcr01100  Metabolic pathways
kcr01120  Microbial metabolism in diverse environments
kcr01130  Biosynthesis of antibiotics
kcr01200  Carbon metabolism
Module
kcr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kcr_1229
   00020 Citrate cycle (TCA cycle)
    Kcr_1229
   00620 Pyruvate metabolism
    Kcr_1229
   00640 Propanoate metabolism
    Kcr_1229
   00650 Butanoate metabolism
    Kcr_1229
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Kcr_1229
   00680 Methane metabolism
    Kcr_1229
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Kcr_1229
Enzymes [BR:kcr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Kcr_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACB07975
UniProt: B1L696
Position
1233999..1234979
Genome map
AA seq 326 aa AA seqDB search
MSTWKPDIKELARKELKTRPIESGHRLCAGCGAGIIIRQIAMAARKPIVWITATGCVEVA
TTIFPYTSWNVPWAHNAFENAAAVGSGVEAARKKLYRSKRFQGDPDVELDYDVVVLGGDG
GTYDIGLQAISGAFERGDKILYVLYDNEAYMNTGIQRSGGTPFGARTTTTPVGRVIKGKI
QFKKPIVDIMVAHRIPYAATISSAYWNDAIVKLRKGFEAEGPAFIHAFSTCPLGWGNETS
ETIKIMKLAVETCVFPLYEVENGQYKLTGPTLAIAKNPDRKKPVEEYLKLQARFRHMLRP
ENKWMVEKFQEWVDREWELLLKKAGL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtccacttggaagcccgatataaaggagttggccagaaaggagcttaagacaagaccc
atagaatccgggcacaggctctgcgctggatgcggggcagggatcataataaggcagata
gctatggccgcgaggaagcccatagtttggattacggcgactggttgcgtcgaggtcgcg
accaccatattcccgtacacttcttggaacgtcccttgggctcacaatgcatttgaaaac
gcagctgccgttggctctggtgttgaagctgctaggaagaagctttacaggtcaaagaga
ttccaaggtgatcctgatgtcgagttagactatgatgtcgttgtcctcggaggtgatgga
gggacttacgatatagggcttcaggcaatatcaggagccttcgagaggggtgataagata
ctctacgttctatacgataacgaggcttacatgaacaccggtatccagagatcgggaggt
actccatttggagctaggacaactactacaccagttggcagagttataaagggtaaaata
cagttcaagaagccgatagtggacataatggtcgctcacaggataccctacgctgcgact
atatcctcagcgtactggaatgatgcaatagtaaagcttaggaaggggtttgaggctgag
gggccagctttcatccatgccttctcgacatgccctctcggatggggtaacgagacatcg
gagacgattaagatcatgaaactagccgttgaaacatgcgtcttccctctgtatgaggtc
gagaatggccaatacaaattaacgggtcctacattagctatagcaaagaatccagacagg
aagaagccggtagaggagtacttaaaactccaggcgagattcaggcatatgctcaggccg
gagaataaatggatggtcgagaagttccaggaatgggttgatagagagtgggagctcctc
ctgaagaaggcgggcctctaa

DBGET integrated database retrieval system