KEGG   Candidatus Korarchaeum cryptofilum: Kcr_1464
Entry
Kcr_1464          CDS       T00668                                 
Name
(GenBank) Transcription factor TFIIB cyclin-related
  KO
K03124  transcription initiation factor TFIIB
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
kcr03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:kcr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    Kcr_1464
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:kcr03021]
    Kcr_1464
Transcription machinery [BR:kcr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     Kcr_1464
 Prokaryotic type
  Archaeal type
    TFB
     Kcr_1464
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon OrfB_Zn_ribbon zf-ribbon_3 Sigma70_r4 Cyclin_C A2L_zn_ribbon zf-RRN7 HTH_AsnC-type Lar_restr_allev Ribosomal_S27e RB_B DZR zinc_ribbon_4 Elf1 Prim_Zn_Ribbon
Other DBs
NCBI-ProteinID: ACB08210
UniProt: B1L6Y1
Position
1447389..1448459
AA seq 356 aa
MTKDLYIILSDYLRQYANGVVSQLPKEPEGRDAPESPGEEIRCPRCGSKNVVEDPNTGDL
VCQNCGLILDSSALDFSKDWRAFDSDEYIERAHAGAPITPLRPGFGLDTDIVLTKGASKK
SVNLLKRAQKHAADSKEKTIEPALRKIRDAADSLVLPQETIEDAATLYRMAARAGLVKGR
SMDAMVAAVIYAACRRTDVPKTLEEISKFFALEEKEIGRSFRFLFRKLGIQIPPPKPENF
VYLIASKLSLPEEVATQAIRIIKIAKRNGATMGREPVGVAAAAVYMACQELGLHRTQREL
AQAANVTEVTVRNRYKELIARARNDWLEEIGEEKLNELKRRVAEYMKVSQAAQPVK
NT seq 1071 nt   +upstreamnt  +downstreamnt
ttgacgaaagatttatatataatactttcggattatcttcggcaatatgctaatggggtg
gtgagtcaactgcctaaggaacccgaggggcgggatgccccagaatctcccggtgaggag
atcaggtgccctagatgtggtagtaagaatgttgttgaggatccaaataccggagaccta
gtctgccagaactgcgggttgatactggattcaagcgcactggacttctccaaggattgg
agagccttcgattcggatgagtatatcgagagagctcatgctggcgctcccataacgcct
ctaaggccaggtttcggtctagacaccgatatagttctcactaagggggccagtaagaag
tccgtgaatctcctgaagagggctcagaagcacgctgcggactccaaggagaagacgata
gagccagcccttaggaagataagggacgcagctgattccctagttctcccgcaggagact
atagaggacgcagcaaccctctacaggatggctgccagggctggactcgttaaggggagg
agtatggatgcgatggtggctgccgtcatttatgctgcctgcaggaggacggatgtcccg
aagactctggaggagatatccaaattcttcgctttggaggaaaaggagatcggaaggagc
ttcaggttcctcttcagaaaattggggatacagatccctccgcccaagcctgagaacttc
gtctacctgatagcatccaagctctcgctaccggaggaagtggcaacgcaggcaatcagg
ataataaagatagcgaaaaggaacggagctactatggggagggaaccagttggagtggca
gcggcagctgtatatatggcctgtcaggaactggggcttcataggactcagagggagtta
gcacaggcagctaatgtcacggaagtcacggtgaggaatagatataaggagcttatagcg
agggctaggaacgattggctcgaggagataggtgaggagaagctgaacgaactgaagagg
agagtagctgagtacatgaaagtctcgcaggccgctcaacccgttaagtaa

DBGET integrated database retrieval system