KEGG   Dokdonia sp. 4H-3-7-5: Krodi_0491Help
Entry
Krodi_0491        CDS       T01484                                 

Definition
(GenBank) isocitrate lyase and phosphorylmutase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00630  Glyoxylate and dicarboxylate metabolism
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01200  Carbon metabolism
Module
kdi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Krodi_0491
Enzymes [BR:kdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Krodi_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEE18477
UniProt: F4AYL0
Position
complement(560119..561729)
Genome map
AA seq 536 aa AA seqDB search
MSNYNSALEVVRSLKAKHGNSWSAISPENTARMAVQNRFKTGLDIATYTASIMRKDMEEY
DANPMSYTQSLGCWHGFVAQQKMIAVKKHHGTTNKKYLYLSGWMVAALRSELGPLPDQSM
HEKTAVPKLIEEIYTFLRQADAVELNDLFRRLDAGEDVQDQIDNYETHIVPIIADIDAGF
GNEEATYLLAKKMIEAGACALQIENQVSDAKQCGHQDGKVTVPHEDFIAKLNALRYAFLE
LGVDEGIIVARTDSEGAGLTQKLPVSQEPGDLASQYLAFVEAEEVDINSANEDDVLLKRD
GKLVRPVRLPNGLYKFKNGSNIDRVVLDCITSLQNGADLLWIETPTPNVKQIAHMVNRVR
AVEPSAKLVYNNSPSFNWTLNFRNQAYDEMVEEGENMTAYDRNNLMDVAYDQTELSHRAD
EKIKTFQRDGALEAGIFHHLITLPTYHTTALHMNNLTEGYFGEQGMLAYVKDVQRQEIRN
GVSCVKHQRMAGSDLGDDHKTFYAGDKALKAGGANNTSNQFQEKKTVLNNKPVLTA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaactacaattcggctcttgaagttgttagatcacttaaagcaaagcatggaaac
tcttggagtgccataagtccagaaaacacagctcgtatggctgttcaaaatagatttaaa
acgggccttgatattgcaacatatactgctagtattatgcgcaaggatatggaagaatac
gatgcaaaccctatgagttatactcagtcgctaggttgctggcacggttttgtggcacag
caaaaaatgattgcagtaaagaaacatcatggtactacaaataaaaagtacttatacctt
tctggatggatggttgccgctttacgttcagagctaggtcctttgccagatcaatctatg
catgaaaagactgctgtgccaaaattaattgaagaaatttatacattcttacgtcaggca
gatgccgtagaacttaatgatttgtttcgtcgtcttgatgcaggtgaggatgtgcaagat
caaattgataattatgaaacgcatatagttccaattatcgcagatatagacgcaggtttt
ggaaatgaagaggctacttatttactagcaaagaaaatgatagaagctggagcatgcgca
ctgcagatagaaaatcaagtatctgatgcaaagcagtgcggtcaccaggatggaaaggtg
acagttcctcatgaagattttattgcaaaacttaacgcactacgttatgcctttttagag
ctaggcgtagatgaaggaattattgtggcaagaacagattctgagggtgcaggtcttact
cagaagttgcctgtaagtcaagagcctggagatctcgcttctcaatacctcgcttttgta
gaggcagaggaagtagatattaatagcgcaaatgaagatgacgtacttcttaaaagagat
ggaaaactggtgcgcccagtgcgattacctaatggtctttacaagtttaagaacggatca
aacatagatagggtagtgcttgattgtattacaagtttgcaaaacggcgcagacctttta
tggatagaaacgcctacgcctaatgtgaagcaaatcgctcatatggtaaatagagtgaga
gcggttgagccaagtgctaagctggtatataataactctccttcttttaactggacactt
aattttagaaatcaagcgtatgatgagatggtagaggagggtgaaaatatgactgcgtat
gatcgtaataatttaatggatgtagcttatgatcagacggaattgtctcatagagcagat
gaaaaaattaaaacattccaaagagacggggcacttgaagcaggaatattccaccatctc
attacattgcctacctatcatactactgcacttcatatgaataatcttacagaaggttat
tttggagagcaaggtatgctggcttatgtgaaagatgtgcaaagacaagagatacgcaat
ggagtatcttgtgtaaaacaccagagaatggcgggttctgatctaggagatgatcacaaa
acgttttatgcgggagataaagctctaaaggctggaggagcaaataatactagtaatcaa
tttcaagagaagaaaacggtattaaataataaacctgttttgacggcgtag

DBGET integrated database retrieval system