KEGG   Dokdonia sp. 4H-3-7-5: Krodi_2847Help
Entry
Krodi_2847        CDS       T01484                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00010  Glycolysis / Gluconeogenesis
kdi00030  Pentose phosphate pathway
kdi00051  Fructose and mannose metabolism
kdi00052  Galactose metabolism
kdi00680  Methane metabolism
kdi01100  Metabolic pathways
kdi01110  Biosynthesis of secondary metabolites
kdi01120  Microbial metabolism in diverse environments
kdi01130  Biosynthesis of antibiotics
kdi01200  Carbon metabolism
kdi01230  Biosynthesis of amino acids
kdi03018  RNA degradation
Module
kdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krodi_2847
   00030 Pentose phosphate pathway
    Krodi_2847
   00051 Fructose and mannose metabolism
    Krodi_2847
   00052 Galactose metabolism
    Krodi_2847
  Energy metabolism
   00680 Methane metabolism
    Krodi_2847
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Krodi_2847
Enzymes [BR:kdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Krodi_2847
Protein phosphatases and associated proteins [BR:kdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Krodi_2847
Messenger RNA biogenesis [BR:kdi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Krodi_2847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEE20822
UniProt: F4B3D5
Position
complement(3228133..3229119)
Genome map
AA seq 328 aa AA seqDB search
MTKKINKIAVMTSGGDAPGMNAAVRSVVRTCAYHNIDCVGIYRGYDGMIEGDFIPLDARS
VRGIINKGGTFLKSARCQRFRTEDGRQIAHNEMVKAGIDALVVIGGDGTFTGALHFSEEF
DFPVIGIPGTIDNDISGTDRTLGYDTALNTAVEAIDKIRDTAHSHDRLFFVEVMGRDVGH
IALNAGVGAGAEEILIPEENMGIERLVESLQRSKISGKSSSIVVVAEGDKIGKSVFELKD
YVDENMEGYDVRVSVLGHMQRGGSPTCYDRVLASRMGVKAVESLLEGKSNFMVGTIHDMM
ELTPLDEAIKGKSKINKELIRVSEIMTT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaataaacaaaatcgcagtgatgacctctggaggagatgctccagggatg
aatgctgctgtgcgttctgtagtgcgtacttgtgcctaccataatatagattgtgttggt
atctacagaggttatgatggaatgattgaaggtgactttattcctctcgatgcaagaagc
gtacgggggattattaataaaggaggaacttttttaaagtctgcaagatgtcaacgcttc
aggacagaagatggaaggcagattgcacacaacgagatggtaaaagccggtatagatgca
cttgttgttataggcggtgatggaacgtttactggagcacttcactttagcgaagagttt
gattttcccgtaataggaatcccaggtactatagataatgatatatctggtacagatcgt
acccttggatatgatacggcacttaatacagcagtagaggcgattgacaaaatacgtgat
actgcacactcacacgacagacttttctttgtagaggtaatgggtcgtgatgtaggccat
attgctcttaacgcaggagtaggggcaggagcagaagaaattttaatcccagaagaaaac
atggggatagaaaggctggtagagtctttacaacgttctaaaatatcaggaaaatcctca
agtattgttgttgtagccgaaggtgataaaataggaaagtctgtttttgaactaaaagac
tatgtagacgagaatatggagggatatgatgtacgagtatctgtactaggtcatatgcag
cgtggaggctctcctacgtgttatgatcgtgttcttgcaagtagaatgggagtaaaggct
gtagagtcacttctagagggtaaaagtaattttatggtgggtactattcatgatatgatg
gagcttacaccactagatgaagcaataaaaggtaaaagtaaaattaataaggaattaatc
cgtgtgtcagagataatgaccacataa

DBGET integrated database retrieval system