KEGG   Komagataeibacter europaeus: S101446_01939Help
Entry
S101446_01939     CDS       T04893                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
keu  Komagataeibacter europaeus
Brite
KEGG Orthology (KO) [BR:keu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    S101446_01939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ARW17055
UniProt: A0A0M0EJ04
Position
2097248..2097724
Genome map
AA seq 158 aa AA seqDB search
MSKNRPFPPPGGEGAESPLGETMDNTPCFEATTDDVRVVVQTFWLDDQSEPDEHRYVWAY
RIRIENHGTEQIQLLRRSWRIVDGKGRIDRVEGDGVVGEQPLIDAAASFEYMSGAALETP
TGFMGGMYHMIRPASRQHFDVSIPVFSLDSPHHPTVLH
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacaggcctttccctccccccggcggggaaggagcggagtccccgctgggc
gagacaatggacaataccccctgtttcgaagcgacgaccgatgacgtgcgcgtggttgtc
cagaccttctggctggatgaccagtcggaaccggacgaacaccgttatgtatgggcttac
cggatccgtatcgaaaaccacggcacggaacagatccagctgctacgccgcagctggcgc
atcgtggacgggaagggacggatcgaccgggtggaaggcgacggcgtggtgggggaacag
ccccttatcgacgccgcggccagtttcgaatacatgtccggggccgcccttgaaacgcca
accggcttcatggggggcatgtaccacatgatccgtcccgccagccggcagcatttcgat
gtcagcattcccgtattcagcctggatagcccgcatcacccgaccgttctccactga

DBGET integrated database retrieval system