KEGG   Kribbella flavida: Kfla_0125Help
Entry
Kfla_0125         CDS       T01155                                 

Definition
(GenBank) dihydrodipicolinate synthetase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
kfl  Kribbella flavida
Pathway
kfl00520  Amino sugar and nucleotide sugar metabolism
kfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Kfla_0125
Enzymes [BR:kfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     Kfla_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ADB29254
UniProt: D2PRS4
Position
136344..137246
Genome map
AA seq 300 aa AA seqDB search
MTSTLEIWAATPTPFGPDGELNLPVVADQGKHLLAHGAHGAFVGGTSGEFPALTTAERKA
LVDEWARTKPAGLALGTHVGHSTLAEAKALAAHAAAAGVDLIASVTPYFGVANTVDTAVD
YLAAVAAEAPSVPFLYYHFPAMTGSPYRPSELVAAAVERIPNFAGVKFTHEDLLEFDRTR
AVSDRIRVYFGRDELLPAALAFGADAVIGSLYNALTPQAHQIAAAMATGRLADALVLHEP
FRQVAVEAGRYGGVGFVKEWLNACGPDTGVARTPWGPLPTAAHDTIERLAASWRAVTPEG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagcacactggagatctgggcggcgacgccgaccccgttcggcccggacggcgag
ctgaacctgccggtggtcgccgaccagggcaagcacctgctggcgcacggcgcgcacggc
gccttcgtcggcggcacctccggggagttccccgccctgaccaccgccgaacgcaaggcg
ctggtcgacgagtgggcgcggaccaagccggccgggctcgcgctcggcacgcacgtcggc
cacagcacgctcgccgaggccaaggccctcgccgcgcacgcggccgccgcgggggtcgac
ctgatcgcctcggtcacgccgtacttcggcgtcgcgaacaccgtggacacggccgtcgac
tacctggccgcggtcgccgccgaggcgccgtcggtgccgttcctgtactaccacttcccg
gcgatgaccggttcgccgtaccggccgagcgagctggtcgcggcggcggtcgagcggatc
ccgaacttcgccggggtgaagttcacccacgaggacctgctcgagttcgaccggacccgc
gcggtgtcggaccggatccgggtgtacttcggccgcgacgagctgctgccggcggcgctg
gccttcggcgcggacgcggtgatcggcagtctgtacaacgcgctcactccgcaggcccac
cagatcgcggcggcgatggcgaccggccggctggccgacgcgctggtgctgcacgagccg
ttccggcaggtcgccgtcgaggccggccggtacggcggggtcgggttcgtgaaggagtgg
ctgaacgcctgcggtccggacaccggcgtcgcccggaccccgtgggggccgctgcccacg
gccgcgcatgacacgattgagcggctcgccgcctcctggcgagccgtgaccccggaggga
tga

DBGET integrated database retrieval system