KEGG   Kribbella flavida: Kfla_1230Help
Entry
Kfla_1230         CDS       T01155                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
kfl  Kribbella flavida
Pathway
kfl00010  Glycolysis / Gluconeogenesis
kfl00071  Fatty acid degradation
kfl00350  Tyrosine metabolism
kfl00625  Chloroalkane and chloroalkene degradation
kfl00626  Naphthalene degradation
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_1230
  Lipid metabolism
   00071 Fatty acid degradation
    Kfla_1230
  Amino acid metabolism
   00350 Tyrosine metabolism
    Kfla_1230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Kfla_1230
   00626 Naphthalene degradation
    Kfla_1230
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Kfla_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 Met_10 ELFV_dehydrog TrkA_N XdhC_C MTS Methyltransf_11 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADB30333
UniProt: D2Q419
Position
1292596..1293618
Genome map
AA seq 340 aa AA seqDB search
MRAVVVERFGVVPEVREVGRPGVPVGGVVVRVQATGLCRSDWHGWQGHDSDIVLPHVPGH
ELAGTIAEVGDGVTGWQVGDRVTTPFICACGTCEQCLAGNHQVCPNQLQPGFNYWGSFAE
YVAVPFAEVNLVRLPDELEFETAAGLGCRFATSFRAVRQVGKVVAGEDVVVFGCGGVGLS
AVMIAAALDARVIAVDTNPGALELARAYGAAATVQAGPRAVEEIRELTGGGAQVTMDALG
SNEIVQQALLALRPRGRHLQVGLLPAGVQLDVSRLIGQELEWLGSHGMAAHAYPEMLELV
ASGVLKPADLIARTISLDEVPAALDALTAGTPAGVTVIRP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctgtggtggtggagcggttcggggtggtgccggaggttcgggaggtggggcgg
ccgggggtgcctgtgggtggggtggtcgtgcgggtccaggcgaccgggttgtgccggagt
gactggcacgggtggcaggggcacgactcggacatcgtgttgccgcatgtgccggggcac
gagttggccgggacgatcgcggaggtgggcgacggcgtcaccgggtggcaggtcggggac
cgggtgacgacgccgttcatctgtgcgtgtgggacgtgcgagcagtgcctcgcgggcaac
caccaggtctgcccgaaccagctgcagccggggttcaactactggggttcgttcgcggag
tacgtcgcggtgccgtttgccgaggtgaacctggttcggctgccggacgagctggagttc
gagacggcggcggggctggggtgcaggttcgcgacctcgttccgggcggtgcggcaggtc
ggcaaggtggtggcgggcgaggacgtcgtggtgttcgggtgcggcggtgtcgggctgtcc
gcggtgatgatcgccgccgcgctggacgcccgggtgatcgcggtcgacacgaatcccggc
gcgctcgaactggcgcgggcgtacggcgcggccgcgaccgtgcaggcgggtccgcgggca
gtcgaggagatccgcgagctgaccggtggcggggcgcaggtgacgatggacgccctcggg
tccaacgagatcgtccagcaggccctgctcgcgttgcggccgcgcgggcggcacctgcag
gtcggtctgctgccggccggcgtgcagctcgacgtgtcgcggctgatcggccaggagctg
gaatggctggggagccacgggatggctgcccacgcctatccggagatgctcgagctggtc
gcgtccggcgtactgaagccggccgacctgatcgcccggacgatctcgctcgacgaggtc
ccggccgccttggacgcgctgacggccgggactcctgccggtgtgacggttatccggccc
tga

DBGET integrated database retrieval system