KEGG   Kribbella flavida: Kfla_1272Help
Entry
Kfla_1272         CDS       T01155                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kfl  Kribbella flavida
Pathway
kfl00020  Citrate cycle (TCA cycle)
kfl00640  Propanoate metabolism
kfl00660  C5-Branched dibasic acid metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01200  Carbon metabolism
Module
kfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kfla_1272
   00640 Propanoate metabolism
    Kfla_1272
   00660 C5-Branched dibasic acid metabolism
    Kfla_1272
Enzymes [BR:kfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Kfla_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp CARDB
Motif
Other DBs
NCBI-ProteinID: ADB30375
UniProt: D2Q461
Position
1329861..1331033
Genome map
AA seq 390 aa AA seqDB search
MDLMEYQAKTVFAKHGVRTTVGEVVTTPEQARAAAEKIGGTVVVKAQVKTGGRGKAGGVK
LASSPDEAEQKAREILGLDIKGHVVKTLNIVPAAAIGEEYYFSFLIDRANRNYLCIASAA
GGMEIEEVAHTNPDAVAKISIDPATGVDEALAREIAEQAGYPADVLDAAAVEIAKLYQVF
IAEDASLVEVNPLVKLEDGNVEALDGKVTLDENADFRHPDHAEFEDSSAEDPLEAAAKAK
GLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEQFGGVKPANFLDIGGGASAEVMANGLE
IIISDPQVESVFVNVFGGITACDAVANGIVQAFELLAGRGEAVNKPLVVRLDGNNAEEGR
RILDEAGLAGLERVDTMDGAAKRAAELAAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgatggaataccaggcgaagacggtcttcgccaagcacggcgtgcggacgacg
gtcggcgaggtcgtcaccacgccggaacaagcccgcgccgccgccgagaagatcggcggc
accgtggtggtcaaggcccaggtgaagaccggcggccgcggcaaggccggcggcgtcaag
ctggcctcctcgcccgacgaggcggagcagaaggcgcgcgagatcctcggcctggacatc
aagggccacgtcgtcaagacgctgaacatcgtgccggccgccgcgatcggcgaggagtac
tacttctcgttcctgatcgaccgggccaaccgcaactacctgtgcatcgcctccgccgcc
ggcggcatggagatcgaggaggtcgcgcacaccaacccggacgcggtcgccaagatctcg
atcgacccggccaccggtgtcgacgaggccctggctcgcgagatcgccgagcaggccggc
tacccggccgacgtgctggacgccgccgcggtcgagatcgccaagctgtaccaggtcttc
atcgccgaggacgcctcgctggtcgaggtgaacccgctggtcaagctcgaggacggcaac
gtcgaggcgctggacggcaaggtcaccctggacgagaacgccgacttccggcacccggac
cacgccgagttcgaggacagctccgccgaggacccgctggaggccgcggccaaggccaag
ggcctgaactacgtgaagctcgacggctccgtcggcatcatcggcaacggcgcggggctg
gtcatgtcgacgctcgacgtggtcgcgtacgccggtgagcagttcggcggcgtcaagccg
gccaacttcctcgacatcggcggcggcgcgtccgccgaggtgatggcgaacgggctggag
atcatcatctccgacccgcaggtggaaagcgtgttcgtcaacgtgttcggcggcatcacc
gcctgcgacgcggtcgcgaacggcatcgtccaggccttcgagctgctggccggccgcggt
gaggccgtgaacaagccgctggtcgtccggctggacggcaacaacgccgaggagggccgc
cgcatcctcgacgaggccgggctggccggtctggagcgggtcgacacgatggacggcgcc
gccaagcgggccgccgagctggctgcgaagtaa

DBGET integrated database retrieval system