KEGG   Kribbella flavida: Kfla_1273Help
Entry
Kfla_1273         CDS       T01155                                 

Definition
(GenBank) succinyl-CoA synthetase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
kfl  Kribbella flavida
Pathway
kfl00020  Citrate cycle (TCA cycle)
kfl00640  Propanoate metabolism
kfl00660  C5-Branched dibasic acid metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01200  Carbon metabolism
Module
kfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kfla_1273
   00640 Propanoate metabolism
    Kfla_1273
   00660 C5-Branched dibasic acid metabolism
    Kfla_1273
Enzymes [BR:kfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Kfla_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ADB30376
UniProt: D2Q462
Position
1331047..1331937
Genome map
AA seq 296 aa AA seqDB search
MSIFLTKDSKVIVQGMTGSEGTKHTTRMLASGTNIVGGVNPRKAGESVDFDGKPVPVFGG
VADAIKETGANVSVVFVPPKFTKDAVLEAIEAEMPLVVVITEGVPVHDTAAFFAAAQASG
KTRIIGPNCPGIITPGESNAGIIPADIAGPGRIGLVSKSGTLTYQMMYELRDFGFSTAIG
IGGDPIIGTTHIDALRAFQDDPDTDAIVMIGEIGGDAEERAAAFIKENVTKPVVGYVAGF
TAPEGKTMGHAGAIVSGSSGTAAAKQEALEAVGVKVGKTPSETANLMREIMQELSK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcttcctgaccaaggacagcaaggtcatcgtccagggcatgaccggctccgag
ggcaccaagcacaccacccggatgcttgcctctggcaccaacattgtcggcggcgtgaac
ccgcgcaaggccggcgagagcgtcgacttcgacggcaagccggtaccggtgttcggtggc
gtcgcggacgcgatcaaggagaccggcgcgaacgtgtcggtggtcttcgtgccgccgaag
ttcacgaaggacgcggtgctggaggcgatcgaggccgagatgccgctggtcgtggtgatc
accgaaggcgtgccggtgcacgacaccgccgcgttcttcgccgccgcgcaggcctccggc
aagacccggatcatcgggccgaactgccccggcatcatcaccccgggcgagtcgaacgcc
ggcatcatcccggccgacatcgccggtccgggccggatcggcctggtctcgaagtccggc
acgctgacgtaccagatgatgtacgagctgcgggacttcggcttctccaccgcgatcggc
atcggtggcgacccgatcatcggcaccacccacatcgacgcgctgcgggcgttccaggac
gacccggacaccgacgcgatcgtgatgatcggcgagatcggcggcgacgccgaggagcgc
gcggcggcgttcatcaaggagaacgtcaccaagccggtcgtcggctacgtggccggcttc
accgcgccggagggcaagacgatgggccacgcgggcgcgatcgtgtccggctcgtccggc
accgccgccgccaagcaggaggcgctggaggccgtcggggtgaaggtcggcaagacgccg
tcggagaccgccaacctgatgcgcgagatcatgcaggagctgtcgaagtag

DBGET integrated database retrieval system