KEGG   Kribbella flavida: Kfla_2585Help
Entry
Kfla_2585         CDS       T01155                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kfl  Kribbella flavida
Pathway
kfl00010  Glycolysis / Gluconeogenesis
kfl00052  Galactose metabolism
kfl00500  Starch and sucrose metabolism
kfl00520  Amino sugar and nucleotide sugar metabolism
kfl00521  Streptomycin biosynthesis
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01200  Carbon metabolism
Module
kfl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_2585
   00052 Galactose metabolism
    Kfla_2585
   00500 Starch and sucrose metabolism
    Kfla_2585
   00520 Amino sugar and nucleotide sugar metabolism
    Kfla_2585
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Kfla_2585
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Kfla_2585
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Kfla_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ADB31653
UniProt: D2PXL1
Position
complement(2715706..2716623)
Genome map
AA seq 305 aa AA seqDB search
MSDEATTVLGIDIGGTKMAAALVAADGRILTEDRIPTPRGDADQVFAALAELIGRVRGEV
TPVAVGIGSAGPLDQRHGLVSPVNIVGWRNFPLVDRVRELVGGVPVELGVDGHCFALGES
WTGAGRGVGTLLGIVVSTGVGAGIVMDGKPLLGQSGNAAHLGHMVVDLDGEVCACGSYGC
VETYASGPRMVARAQRRGWRSGELVDAAMLSADAAAGDEIALAVFDDGAQALAAGIVATA
VTVDLTTVVIGGGVAKAGPVLFDPVGRWVKRLAQLPFVADLTVEPAQLANAGLLGAARLA
WATTA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaggcaacgaccgttctcggcatcgacatcggcggcacgaagatggccgcc
gcgctggtggccgctgacggccggatcctcaccgaggaccggatccccacgccgcgcggc
gacgccgaccaggtgttcgccgccctggccgagctgatcggccgggttcgcggcgaggtc
accccggtggccgtcggcatcggctcggcgggcccgctcgaccagcggcacggcctggtc
tcgccggtgaacatcgtcggctggcggaacttcccgctcgtcgaccgggtccgggagctg
gtcggcggcgtaccggtggagctcggggtcgacggccactgcttcgccctgggcgagtcg
tggaccggcgccggccgcggggtcggcacactgctgggcatcgtggtctcgaccggggtc
ggcgccggcatcgtgatggacggcaagccgctgctcggccagtccggcaacgccgcccac
ctcgggcacatggtcgtcgacctggacggcgaggtgtgcgcgtgcgggtcgtacggctgc
gtggagacgtacgccagcggcccgcggatggtggcgcgggcgcagcgccgaggctggcgg
tccggcgagctggtcgacgccgcgatgctgtcggcggacgccgcggccggggacgagatc
gcgctcgcggtgttcgacgacggcgcgcaagcgctggccgccggcatcgtcgcgaccgcg
gtcaccgtggacctcaccaccgtcgtcatcggcggcggcgtcgcgaaggccggtccggtc
ctgttcgacccggtcggccgctgggtgaagcggctggcgcagctgccgttcgttgccgac
ctcaccgtcgagccggcgcagctggccaacgccggcctgctcggcgccgcgcggctggcc
tgggcgaccacggcctga

DBGET integrated database retrieval system