KEGG   Kribbella flavida: Kfla_2885Help
Entry
Kfla_2885         CDS       T01155                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
kfl  Kribbella flavida
Pathway
kfl00471  D-Glutamine and D-glutamate metabolism
kfl00550  Peptidoglycan biosynthesis
kfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Kfla_2885
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Kfla_2885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kfl01011]
    Kfla_2885
Enzymes [BR:kfl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Kfla_2885
Peptidoglycan biosynthesis and degradation proteins [BR:kfl01011]
 Precursor biosynthesis
  Amino acid ligase
   Kfla_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C F420_oxidored TrkA_N ThiF Pyr_redox_2 KR NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADB31950
UniProt: D2Q0F8
Position
3060109..3061548
Genome map
AA seq 479 aa AA seqDB search
MSVTTRTDDGWQTTRFVVLGFGTAGYACADSLLQAGAEHVVVLDDRDTEQLREKAQILGT
LGAEIRLGPGSTAELPAGVEVVVTSPGIPPHAPLLAAAAERDVPVWSEIELAWRLRDPAN
AAPWLCVTGTNGKTTTVQMLTAMLTAAGHRAVAAGNVGLPLLEAVMDPEPYDVIAVELSS
YQLHFTHSMSAHSAAVLNLAPDHVDWHGSLEAYAADKGRIFENCQVACVYNVADAATEKL
VEQADVVEGCRAIGFTLGTPGLSMLGLVDEYLVDRAFVEQRATSALELATLADITPPAPH
NVANALAAAALARAFGVPATAVRDGLRGFRPDAHRIAHVAEVAAVNYVDDSKATNPHAAQ
ASLLAYEHVVWIAGGQAKGATFDELVTAARSRLRGVVLLGQDKAVIAQALARHAPDVPVI
TVEATDTGAMETVVGEAAKLAQVGDTVLLAPGCASWDMFANYGARGDAFAAAVRRLGDR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcaccacaaggaccgacgacggctggcagaccacgcggttcgtcgtcctcggg
ttcggtacggcgggctacgcgtgcgccgactcgttgctgcaggccggcgccgagcacgtc
gtcgtcctggacgaccgggacaccgagcagctgcgggagaaggcgcagatcctcggcacg
ctcggcgcggagatccggctcggcccgggcagcacggccgagctgcccgcgggtgtcgag
gtcgtcgtcacctcgccgggcatcccgccgcacgcgccgctgctggccgcggcggccgag
cgcgacgttccggtctggagcgagatcgagctggcctggcggctgcgcgacccggcgaac
gccgcgccctggctgtgcgtcaccgggaccaacggcaagaccaccacggtccagatgctg
accgcgatgctgaccgcggccggccaccgtgccgttgccgccggcaacgtcgggctgccg
ctgctggaggcggtgatggaccccgagccgtacgacgtgatcgcggtcgagctgtccagc
taccagctgcacttcacccactcgatgtccgcgcactccgcggccgtgctcaacctcgcg
ccggaccacgtcgactggcacggttcgctggaggcctacgcggccgacaagggcaggatc
ttcgagaactgccaggtcgcctgcgtctacaacgtcgccgacgcggccaccgagaagctg
gtcgagcaggccgacgtggtcgagggctgccgggcgatcggcttcaccctcggtacgccg
gggctgtcgatgctcgggctggtcgacgagtacctggtggaccgcgcgttcgtcgagcag
cgggccacctcggcgctggagctggccaccttggccgacatcaccccgccggctccgcac
aacgtggcgaacgcgctcgcggcggccgcgctggcccgggcgttcggcgtaccggcgacg
gcggtccgcgacgggctgcgcgggttccggccggacgcgcaccggatcgcgcacgtcgcg
gaggttgccgcagtcaactacgtggacgactccaaggcgaccaacccgcacgccgcgcag
gcctcgctgctggcctacgagcacgtggtctggatcgccggcgggcaggccaagggcgcc
accttcgacgaactggtgaccgcggcccggtcgcggctgcgcggcgtggtgctgctcggc
caggacaaggccgtgatcgcgcaagcacttgcccgacacgcgcccgatgtcccggtgatc
actgtcgaggcaacggacactggagccatggagaccgtggtgggggaggcggcgaagctt
gcgcaggtgggggacaccgtgctgctcgcgcccggctgcgcttcgtgggacatgttcgcc
aactacggagcccgcggagacgccttcgccgcagccgtccgacggcttggcgaccgctga

DBGET integrated database retrieval system