KEGG   Kribbella flavida: Kfla_3691Help
Entry
Kfla_3691         CDS       T01155                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
kfl  Kribbella flavida
Pathway
kfl00860  Porphyrin and chlorophyll metabolism
kfl01100  Metabolic pathways
Module
kfl_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kfla_3691
Enzymes [BR:kfl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Kfla_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 VirC1 MobB DJ-1_PfpI GATase
Motif
Other DBs
NCBI-ProteinID: ADB32746
UniProt: D2PNS8
Position
complement(3970693..3972153)
Genome map
AA seq 486 aa AA seqDB search
MNSLLIAGTTSDAGKTTVVTGLCRWLARQGVRVAPFKAQNMSNNSMVCADGAEIGRAQWI
QAVAAGAAPEAAMNPVLLKPGSDRRSHVVLMGEPWGELTARGFLTERAELAKAAFAAYDD
LASRYDVVVSEGAGSPTEINLRQSDYVNMGLARHAQAPVVVVGDIDRGGVFASMFGTVAL
LSTDDQRLVSGFVVNKFRGDVSLLRPGIDMLTGVTGRPTYGVLPWLPDLWLDSEDALDLP
ARRTSTDGDVLTIAVVRFPRISNFTDLDALAVEPTTSVFFTAGPAEVRDADLVVLPGSRA
TTADLAWLREHGLADAVQARVAAGRPVLGICGGYQMLGGMIDDPYGVESGGRHTGLGLLP
VATEFAAAKVLARPARTAYEIHHGVVAQTAEADDFPGGCRSGVVWGTIWHGLLDDDAARH
RFLGEIAALTGKPAPDGTVSFAGLRERRLDRLADAIDEHLDTAALMTLIEKGAPADLRFV
PPGAPG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgctgctgatcgccgggacgacctccgacgcgggcaagacgaccgtggtgacg
gggttgtgccggtggttggcgcggcaaggggtgcgggtcgccccgttcaaggcgcagaac
atgtcgaacaactcgatggtctgcgcggacggggcggagatcggccgggcgcagtggatc
caggcggtcgcggccggcgcggcgccggaggccgcgatgaacccggtgctgctgaagccc
ggcagcgaccggcgcagccacgtcgtactgatgggggagccgtggggcgagctgaccgcc
cgcggcttcctgaccgaacgggccgaactggccaaggcggcgttcgcggcgtacgacgac
ctcgcgtcccggtacgacgtggtggtcagcgagggggcgggcagtccgaccgagatcaac
ctgcggcagtccgactacgtgaacatggggctggcccggcacgcgcaggcgccggtggtg
gtggtcggggacatcgatcgcggtggggtgttcgcctcgatgttcggcacggtggccttg
ctctcgaccgacgaccagcggctggtcagcgggttcgtggtgaacaagttccgcggtgac
gtctcgctgctgcggcccggcatcgacatgctcaccggcgtcaccggccgtccgacgtac
ggcgtgctgccgtggctgccggacctgtggctggactccgaggacgcgctggaccttccg
gcccggcggacgagcaccgacggcgacgtgctgacgatcgcggtggtgcggttcccgcgg
atcagcaacttcaccgacctggacgcgctggccgtcgagccgaccaccagtgtcttcttc
accgccggcccggccgaggtgcgcgacgcggacctggtcgtgctgccgggctcgcgggcg
acgaccgccgacctggcctggttgcgggagcacgggctggccgacgcggtccaggcccgg
gtcgcggcggggcggccggtgctcgggatctgcggtggctaccagatgctcggcggcatg
atcgacgacccgtacggcgtcgagagcggcgggcggcacaccgggctggggttgttgccg
gtagccaccgagttcgccgcggccaaggtgctcgcccggccggcgcggacggcgtacgag
atccatcacggggtggtggcgcagaccgccgaggcggacgacttcccgggcgggtgccgc
agcggggtggtgtggggcacgatctggcacgggctgctggacgacgacgcggcccggcac
cggttcctcggcgagatcgccgcgctgaccggcaagccggcgccggacggcacggtctcc
ttcgccgggctgcgggagcgtcgcctggaccggctggccgacgcgatcgacgagcacctg
gacaccgctgcgctgatgacgctgatcgagaagggtgctccggccgacctgcggttcgtc
ccacccggcgctcccggctga

DBGET integrated database retrieval system