KEGG   Kribbella flavida: Kfla_3728Help
Entry
Kfla_3728         CDS       T01155                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
kfl  Kribbella flavida
Pathway
kfl00860  Porphyrin and chlorophyll metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
Module
kfl_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kfla_3728
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Kfla_3728
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Kfla_3728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 DsrH FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADB32783
UniProt: D2PNW5
Position
complement(4009432..4010907)
Genome map
AA seq 491 aa AA seqDB search
MNARTVVVVGGGISGLAAAHALVAGDAPGADSSSPRRTPRVIVLEGATRLGGKLAGDVLE
GVPVDLGAESVLARRPEAVDLIRAVGLGNDVVHPATTSAGLWIGNRILPIPPTVMGVPVD
PAATVDVLGEQAAARVAREAELPEPALTEDVAIGRFVADRMGPAVTDKLIDPLLGGVYAG
RADEISLAAAVPELYAKLRTAPSVLAATAELRATSRRRAADGSPVFAGIRGGINRLVQAL
EADLTARGVEIRRSTTVRRISRGTDDASGTSAGRYVLETGPVPAPQLVHADAVIVATPAS
PAARMLAQLVPAASAELATIDYASMAIVTLAVRKSDWPAGTTGSGFLVPSVEGRTIKAST
YSHAKWQWSAEAGGDLAVLRCSVGRLGEEYVLQRSDEELVALAAADLKTAIGLDAPVVGA
LVSRWGGGLPQYAVGHLDRIDRVEAAVAEQPGLAVCGAAYRGVGIAACVASAGRAVTRVR
SHLDALATMGS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcacggacggtggttgttgtcggtggagggatcagcgggctggcggcggcgcac
gcgctggtcgcgggagacgcgccgggggcggactcgtcctctccgcggcgtacgccgcgg
gtgatcgtgctggaaggagcgactcggctgggcgggaagctggccggggacgtgctcgaa
ggcgtgccggtcgacctgggcgccgagtccgtgctggcccgcaggccggaggcggtggac
ctgatccgggccgtcggcctggggaacgacgtggtgcacccggcgacgacctccgctggg
ttgtggatcggcaaccggatcctgccgattccgccgacggtgatgggcgtgccggtcgac
ccggcggcgacggtcgacgtgctgggggagcaggccgccgcgcgcgtcgcccgggaggcc
gagttgcccgagcccgcgctcaccgaggacgtggcgatcgggcggttcgttgccgaccgc
atgggaccggccgtgaccgacaagctgatcgacccgttgctcggcggcgtctacgcgggc
cgggccgacgagatctcgcttgcggccgccgtgcccgagctctacgccaaactgcggacc
gcccccagcgtgctcgccgcgaccgccgagctgcgggcgaccagccggcgccgggcagcg
gacggttctccggtgttcgccgggatccgcggcggcatcaaccgtctcgtccaggcgctg
gaggccgacctgaccgctcgtggcgtcgagatccgccggtcgacgaccgtacgccggatc
agccgcggcaccgacgacgcgtccggtacgtcggccgggcgctacgtcctggagaccggt
ccggtcccggcgccacaacttgtccacgccgacgcggtgatcgtcgcgacgccggcctcg
cccgcggcgcggatgctggcgcagctggtcccggcggcgtccgccgagctggcgacgatc
gactacgcaagcatggcgatcgtcacgctcgcggtccgcaagagcgactggccggccggc
acgacgggctccggcttcctcgtgccgtcggtcgaaggccgcacgatcaaggcgtcgacg
tactcgcacgcgaagtggcagtggtccgcggaagccgggggagaccttgccgtgctgcgc
tgctcggtcgggcggctcggcgaggagtacgtgctgcagcgctccgacgaggaactggtt
gctctggcggccgccgacctgaagaccgcgatcggcctggatgcaccggtcgtcggcgcg
ttggtgtcccggtggggtggcgggcttccgcagtacgccgtcgggcacctggaccggatc
gaccgggtggaggccgcggtcgccgagcagcccggactggcggtctgcggcgcggcgtac
cggggggtcgggatcgcggcgtgcgtggcctcggccggccgggcggtcacccgggtgcgg
agccacctggacgcattggcgacaatgggatcgtga

DBGET integrated database retrieval system