KEGG   Kribbella flavida: Kfla_3773
Entry
Kfla_3773         CDS       T01155                                 
Name
(GenBank) major facilitator superfamily MFS_1
Organism
kfl  Kribbella flavida
SSDB
Motif
Pfam: MFS_1 MFS_2 Sugar_tr MFS_1_like
Other DBs
NCBI-ProteinID: ADB32827
UniProt: D2PP09
Position
4061275..4062474
AA seq 399 aa
MLMPYVHLMRRPGAAAFCAAGILGRMPISMIGLGIVILIAEESGSYGLAGAVSGVAVVAG
AITGPVQGRLVDRFGQRTLLLVGSVVCTVALAALLVAVRADAPTALLYLLSFVAGGTRPQ
VGSFVRARWTHLLGRGRALQTAFALEAVGDEVVFIVGPVLVTALATQVSPYAALGVAGLL
GLGGGIWLALLRRSDPPGRGKSNGTEQAPLPWLSLLLLSVIGLGLGATLGSAEVVTIAFT
AAEGQPGMSGVVLAVWAFGSLLAGLWYGSVHWRAPVERRLLIGTILLAISLAPLPWVGST
LALGGVLFCAGLTIAPTMVAVTACVEEWVPPQRLTEAITWTVTGILFGVAPGNALAGHAV
DRYGASSAYWVPVGIGVLCAVVAACSITFARPKTRFAHN
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgctgatgccctacgtccacctcatgcgccgtcccggtgccgccgcgttctgcgccgcc
gggatcctcgggcgtatgccgatctcgatgatcggtctgggcatcgtcatcctgatcgcc
gaggagagcggctcgtacggtctggccggcgcggtctccggcgtggccgtggtcgccggc
gcgatcaccggaccggtgcagggccggctggtcgaccggttcggccagcggacgctgctg
ctggtcggcagcgtggtctgcacggtcgcgctggccgcgctgctggtggcggtcagggcc
gacgcgccgaccgccctgctgtacctgctctcgttcgttgccggtggcacgcgtccgcag
gtcggctcgttcgtccgggcccgctggacccacctgctcggccgcggccgggcgctgcag
accgcgttcgcgctggaggccgtcggcgacgaggtggtgttcatcgtcggcccggtcctg
gtcaccgcactcgccacccaggtcagcccgtacgccgcgctcggtgtggccggactcctc
ggcctgggtggaggcatctggctggcactgctccggcggtccgacccgccgggccgcggc
aagtccaacggcaccgagcaggccccactcccctggctctcgctgctgctgctcagcgtg
atcggtctgggcctgggagcgacactcggcagcgctgaggtcgtcaccatcgcgttcacc
gccgcagagggtcaaccgggcatgtcaggcgtcgtactggcggtctgggcgttcgggtcg
ctgctggccgggctctggtacggctcggtgcactggcgggctccggtcgagcgccggctg
ctgatcggcacgatcctgctcgccatctcgctggcgccgttgccctgggtcggcagcacc
ctcgctctgggtggagtgctgttctgcgccggactgacgatcgcaccgacgatggtcgcc
gtcacggcgtgcgtggaggagtgggtcccgccgcaacggctgaccgaggcgatcacctgg
accgtcaccggcatcctgttcggcgtcgcacccggcaacgcgctggccgggcacgcggtc
gaccggtacggcgcctcctcggcgtactgggtgccggtggggatcggcgtgctctgcgcc
gtggtcgccgcctgctcgatcaccttcgcccggccgaagacccgcttcgcgcacaactga

DBGET integrated database retrieval system