KEGG   Kribbella flavida: Kfla_5015Help
Entry
Kfla_5015         CDS       T01155                                 

Definition
(GenBank) D-aspartate oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
kfl  Kribbella flavida
Pathway
kfl00260  Glycine, serine and threonine metabolism
kfl00311  Penicillin and cephalosporin biosynthesis
kfl00330  Arginine and proline metabolism
kfl00472  D-Arginine and D-ornithine metabolism
kfl01100  Metabolic pathways
kfl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kfla_5015
   00330 Arginine and proline metabolism
    Kfla_5015
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Kfla_5015
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Kfla_5015
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Kfla_5015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 ApbA NAD_binding_8 Pyr_redox_2 Pyr_redox GIDA UDPG_MGDP_dh_N 3HCDH_N HI0933_like Thi4 FAD_binding_3 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADB34031
UniProt: D2Q3A8
Position
5413187..5414113
Genome map
AA seq 308 aa AA seqDB search
MRVIVVGAGVIGLTCAVRLAEAGYDVGLFARDLPLETTSAVSAAIWYPYLAAPEDRVADW
ARTSYAEFAELAQSQPAVRMRRGREFLTTPRPDPFWADVPADFERIAAPPAGFQDGWSFS
TPVVEMPLYLQYLVQRLEAAGGSLTRAALSALPNSAEVVVNCAGLGARLTAGDPTVTPVR
GQVLTVEQFGLTEWLLADQNPHDLTYVVPRSHDVVIGGTSRPDSWDLAVDADTAQAMLDR
AAALVPGLRNAKVLKHRVGLRPARPAVRCQSVHVGDQTVVHCYGHGGSGVTLSWGCADEV
LALVKNAA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgatcgtggtgggtgccggcgtgatcgggctgacgtgtgccgtccggctggcc
gaggcggggtacgacgtcgggctgttcgcgcgggatctgccgctggagaccacgtcggcg
gtgtcggccgcgatctggtacccgtacctggccgcgcccgaggaccgggtcgccgactgg
gcgcgcacgtcgtacgccgagttcgccgagctggcgcagagccagccggcggtgcggatg
cggcgcgggcgggagttcctgaccaccccgcggccggatccgttctgggcggacgtacct
gctgacttcgagcgaatcgcggcgccgcccgcgggcttccaggacggctggtcgttcagc
acgccggtggtcgagatgccgctctacctgcagtacctcgtgcagcggctggaggcagcg
ggtggctcgctgacccgagccgcgctgtccgccctgccgaactcggccgaagtggtggtg
aactgcgccggcctcggcgcccggctgaccgccggcgatcccaccgtgacgccggtccgc
ggccaggtgctgaccgtcgagcagttcggcctgaccgagtggctgctcgcggaccagaac
ccgcacgacctgacgtacgtcgtaccgcggtcgcacgacgtcgtcatcggcggcacgagc
cggccggacagctgggacctggccgtcgacgccgacaccgcccaggcgatgctcgaccgg
gccgcggcgctcgttcccggcctgcgcaacgccaaggtactcaagcaccgcgtcggcctg
cgcccggcgcggccggcggtgcggtgtcaaagcgtgcatgtcggcgaccagaccgtcgtt
cactgctatggccacggcggttccggtgtcacactcagctggggctgtgccgacgaggtt
ctggccctggtcaagaacgcggcctga

DBGET integrated database retrieval system