KEGG   Kribbella flavida: Kfla_6330Help
Entry
Kfla_6330         CDS       T01155                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
kfl  Kribbella flavida
Pathway
kfl00860  Porphyrin and chlorophyll metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
Module
kfl_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
kfl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:kfl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kfla_6330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kfl01007]
    Kfla_6330
Enzymes [BR:kfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Kfla_6330
Amino acid related enzymes [BR:kfl01007]
 Aminotransferase (transaminase)
  Class III
   Kfla_6330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADB35332
UniProt: D2PWV2
Position
complement(6768039..6769361)
Genome map
AA seq 440 aa AA seqDB search
MAAVPDHTARSAALFDQATAVTPGGVNSPVRAFRAVGGVPRFMTSGDRCHITDVDGTTYL
DLVCSWGPMLLGHAHPEVTAAVQAAVARGTSYGTPTETEVLLAQEIVGRTPVDKVRLVSS
GTEATMSALRLARGFTGRDKIVKFAGCYHGHVDALLAQAGSGVITLGIPGTPGVTEATTA
DTIVLPYNDQAAVTAAFAQYGDQIAAVITEASPGNMGVVPPADDFNGFLAGICRDNGALF
ISDEVMTGFRITRSGWYGVDGVQPDLMTFGKVMGGGFPAAAFGGRADVMSHLAPEGSVYQ
AGTLSGNPVATAAGLATLRLATDEVYAQLDETSATIQRLVGTALDKEGVPYVIQSAGNLF
SVFFVDSEKGGGPIRDFAGASAQVLPRFAAFFHAMLDAGVYLPPSAFEAWFVSAAIDDDA
LARLESALAPAARAAAAVPN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgcccgaccacaccgctcgctccgccgctctgttcgaccaagccaccgcg
gtcacgcccgggggcgtgaactccccggtccgcgcgttccgtgccgtcggcggggtcccc
cgcttcatgacctcgggtgaccgatgtcacatcaccgacgtcgacggcaccacctacctg
gacctggtctgctcctggggcccgatgctgctgggccacgcccaccccgaggtgacggcc
gccgtccaggccgcggtcgcccggggtacgtcgtacgggacgccgaccgagaccgaggtg
ctgctggcgcaggagatcgtcggccggaccccggtcgacaaggtccggctggtctcctcc
ggcaccgaggcgacgatgtcggcgctgcggctggcccgcgggttcaccgggcgggacaag
atcgtcaagttcgccggctgctaccacgggcacgtcgacgcgctgctggcccaggccggc
tcgggcgtgatcacgctcggcatcccgggcacgcccggcgtcaccgaggcgaccaccgcg
gacacgatcgtgctgccctacaacgaccaggccgcggtcaccgccgccttcgcgcagtac
ggcgaccagatcgcggcggtgatcaccgaggcctcgcccggcaacatgggcgtcgtgccg
ccggccgacgacttcaacggcttcctggccgggatctgccgggacaacggcgcgctgttc
atctccgacgaggtgatgaccggcttccggatcacccgctcgggctggtacggcgtcgac
ggtgtgcagccggacctgatgaccttcggcaaggtgatgggcgggggcttccccgcggcg
gccttcggtggccgggccgacgtcatgtcccacctggcgccggagggctcggtctaccag
gccggcaccctgtccgggaatccggtcgccaccgcggccggcctggccacgctgcggctg
gccaccgacgaggtctacgcgcagctcgacgagacctccgccaccatccagcgcctggtc
ggcaccgcgctggacaaggagggtgtgccgtacgtcatccagtccgccgggaacctcttc
agcgtcttcttcgtggactccgagaagggcggtggcccgatccgcgacttcgccggggcg
agtgcccaggtgctgccacggttcgccgcgttcttccatgccatgctggacgccggtgtc
tacctgccgccgagcgcgttcgaggcgtggttcgtgagcgccgcgatcgacgacgacgcg
ctggcccggctggagtcggcgctggccccggccgcccgcgcggcggccgccgtaccgaac
tga

DBGET integrated database retrieval system