KEGG   Kribbella flavida: Kfla_6467Help
Entry
Kfla_6467         CDS       T01155                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
kfl  Kribbella flavida
Pathway
kfl00790  Folate biosynthesis
kfl01100  Metabolic pathways
Module
kfl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kfla_6467
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Kfla_6467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ADB35464
UniProt: D2PY96
Position
complement(6923303..6923899)
Genome map
AA seq 198 aa AA seqDB search
MPAGCAAPVTSPKFDHERAERAVRELLIAIGEDPDREGLKETPARVARSYEEITAGLGLT
ASDVLTTTFDLGHDEMILVKDIEVWSLCEHHLVPFTGVAHVGYIPNPDGRITGLSKLARL
VDVYAKRPQVQERLTTQVAESLVELLQPRGVIVVIECEHLCMTMRGVRKPGARTITSAVR
GQLRNPSTRAEAMSLIVG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgccggccggctgcgcggcgcccgtgacgtcgccgaagttcgaccacgagcgggccgag
cgggcggtccgggagctgctgatcgcgatcggcgaggacccggaccgcgaaggactgaag
gagaccccggcccgggtggctcgctcgtacgaggagatcaccgccgggctggggctcacc
gcgtcggacgtgctgaccacgacgttcgacctcggccacgacgagatgatcctggtcaag
gacatcgaggtctggtcgctgtgcgagcaccatctggtgcctttcaccggggtcgcgcac
gtcggctacatccccaacccggacggccggatcaccggcctgtccaagctggcccggctg
gtcgacgtctacgccaagcgcccgcaggtccaggagcggctgaccacccaggtcgccgag
tccctggtcgagctgctgcagccgcgcggggtgatcgtggtgatcgagtgcgagcacctc
tgcatgacgatgcgcggcgtgcgcaaacccggcgccagaaccatcacctccgccgtccgc
ggccagctccgcaacccctccacccgcgccgaagccatgagcctcatcgtcggctga

DBGET integrated database retrieval system