KEGG   Kocuria flava: AS188_01680Help
Entry
AS188_01680       CDS       T04206                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kfv  Kocuria flava
Pathway
kfv00260  Glycine, serine and threonine metabolism
kfv01100  Metabolic pathways
kfv01110  Biosynthesis of secondary metabolites
kfv01120  Microbial metabolism in diverse environments
kfv01130  Biosynthesis of antibiotics
kfv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AS188_01680
Enzymes [BR:kfv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AS188_01680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase LRRCT
Motif
Other DBs
NCBI-ProteinID: ALU38673
UniProt: A0A0U2YT28
Position
362579..363646
Genome map
AA seq 355 aa AA seqDB search
MTSSPLTRHDPARRGFGSDNHAGVHPAVLEALAAANGGHVGAYGADPYTEALQDVARRHF
GAQAECHPVFNGTGANVVALAAMTDRWDAVVCTDSAHVDVDECGAPEKLAGVKLLPVPSS
DGKLTPELVDRRAHGFGVEHHAQPRAITVSQSTELGTLYTPDQLRALCEHAHGLGLSVHL
DGARLANAAAALGVPLRALTTDAGVDVVSWGGTKNGALGAEAVVVLDPAAVRQPRFVRKL
SAQLASKMRFVSAQLLALHEGELWRESAAHANAAARRLADGLAAVPGVRITQAVEANAVF
AVLPAGSAERLQRRWPFHVWDGTTGEVRLMCSWDTAAEDVDAFVAALREDAATAP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccagccccctgacccgccacgaccccgcgcgccgcggcttcggcagcgacaac
cacgccggggtccacccggccgtgctcgaggccctcgccgccgccaacggcgggcacgtg
ggcgcctacggcgcggacccgtacaccgaggcgctccaggacgtggcccgccgccacttc
ggcgcgcaggccgagtgccacccggtcttcaacgggacgggggccaacgtcgtcgccctc
gcggccatgaccgaccgctgggacgcggtggtgtgcacggactccgcccacgtcgacgtg
gacgagtgcggggcccccgagaagctcgccggggtgaagctgctgccggtgcccagctcc
gacgggaagctgacccccgagctcgtggaccgccgggcccacggcttcggcgtcgagcac
cacgcccagccgcgggcgatcacggtctcgcagtcgacggagctcggcaccctctacacc
cccgaccagctgcgggcgctgtgcgagcacgcccacgggctcgggctgagcgtccacctc
gacggggcccggctggccaacgccgccgcggccctgggggtgccgctgcgggcgctgacc
accgacgccggcgtcgacgtcgtctcctggggcgggacgaagaacggtgccctgggcgcg
gaggcggtcgtggtgctcgaccccgcggccgtgcggcagccgcggttcgtgcgcaagctc
tcggcccagctggcctcgaagatgcgcttcgtctccgcccagctgctcgccctgcacgag
ggcgagctgtggcgggagtccgcggcgcacgccaatgccgctgcccgccggctcgccgac
ggcctcgccgccgtgcccggcgtccggatcacccaggcggtcgaggccaacgccgtgttc
gcggtgctgcccgccgggtcggccgagcggctgcagcggcggtggccgttccacgtgtgg
gacgggaccaccggggaggtccggctgatgtgctcgtgggacacggccgccgaggacgtc
gacgcgttcgtggcggccctgcgcgaggacgccgccaccgccccctga

DBGET integrated database retrieval system