KEGG   Kocuria flava: AS188_04920Help
Entry
AS188_04920       CDS       T04206                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kfv  Kocuria flava
Pathway
kfv00620  Pyruvate metabolism
kfv00630  Glyoxylate and dicarboxylate metabolism
kfv01100  Metabolic pathways
kfv01110  Biosynthesis of secondary metabolites
kfv01120  Microbial metabolism in diverse environments
kfv01200  Carbon metabolism
Module
kfv_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS188_04920
   00630 Glyoxylate and dicarboxylate metabolism
    AS188_04920
Enzymes [BR:kfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AS188_04920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ALU39205
UniProt: A0A0U3H8H5
Position
complement(1087227..1088840)
Genome map
AA seq 537 aa AA seqDB search
MTTSTIEHVLPPALERAGEILTDEALAFVAELHRRFASRREELLGAREDNRRAAAASGTL
DFLPETKQIRESEWTVAPAPPALQDRRVEMTGPAAPAKMAINALNSGAKVWLADLEDASS
PTWHNQVDGILNLRDAARGTLSFTSPEGKEYSLRQDAPLAVVVARPRGWHLPEHNVTVDG
KPASGSLVDFGLHFFHTARQLLANGHGPYYYLPKMESHLEARLWNDVFTFAEEHLGIEHG
TIRATVLIETIPAAFQMDEILWELRDHASGLNAGRWDYLFSIIKYFRDAGEKFVLADRST
ITMTAPLMRAYTELLVKTCHRRGAFAMGGMAAFIPNRREPEVTEAAFAKVRADKTREAED
GFDGSWVAHPDLVATCREVFDAVLGEKPNQVDRLREDVQVTPEQLLDVPSAGAVRTQKEL
ALNLYVAIRYTAVWLSGNGAVAIHNLMEDAATAEISRSQVWQQIRNGVVYEDTGATATRE
LVAEELERQKEVLRGEVDAQSFEKHFEPAARLIADLVLGEEYVDFLTLPAYDLIEGR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcaccatcgagcacgtcctgccgccggcgcttgagcgcgccggggagatc
ctcaccgacgaggccctcgccttcgtggcggagctgcaccgccgcttcgcgtcccgccgc
gaggagctcctcggcgcgcgcgaggacaaccgccgcgccgccgccgcgagcggcaccctc
gacttcctgccggagacgaagcagatccgggagagcgagtggacggtcgcaccggcgccg
ccggcgctgcaggaccggcgggtcgagatgaccggcccggccgcccccgccaagatggcg
atcaacgccctgaactccggggcgaaggtctggctggccgacctcgaggacgcctcgagc
cccacctggcacaaccaggtcgacggcatcctcaacctgcgcgacgccgcccgcggcacc
ctctccttcacctcccccgagggcaaggagtacagcctgcgccaggacgcgccgctggcc
gtcgtcgtcgcccgcccccgcggctggcacctgcccgagcacaacgtcacggtcgacggg
aagccggcctccgggtccctggtggacttcggcctgcacttcttccacaccgcccggcag
ctgctggccaacggccacggaccgtactactacctgccgaagatggagtcccacctcgag
gcccggctgtggaacgacgtgttcaccttcgccgaggagcacctgggcatcgagcacggc
acgatccgcgcgaccgtgctcatcgagaccatcccggccgcgttccagatggacgagatc
ctctgggagctgcgcgaccacgcctccgggctcaacgccgggcgctgggactacctgttc
agcatcatcaagtacttccgcgacgcgggcgagaagttcgtcctggcggaccgctccacg
atcaccatgaccgccccgctgatgcgcgcctacaccgagctgctcgtgaagacctgccac
cgccgcggagccttcgcgatgggcgggatggccgcgttcatccccaaccgccgcgagccg
gaggtcaccgaggcggccttcgccaaggtgcgggccgacaagacccgcgaggccgaggac
ggcttcgacggctcgtgggtggcccaccccgacctggtcgccacctgccgcgaggtcttc
gacgccgtgctcggtgagaagcccaaccaggtggaccgcctgcgcgaggacgtgcaggtc
acccccgagcagctgctcgacgtccccagcgccggcgccgtgcgcacccagaaggagctc
gccctcaacctctacgtcgcgatccgctacaccgcggtgtggctgtcgggcaacggcgcg
gtggccatccacaacctcatggaggacgccgcgacggccgagatctcccggtcgcaggtc
tggcagcagatccgcaacggcgtggtctacgaggacaccggtgccacggccacccgtgag
ctcgtggccgaggagctcgagcggcagaaggaggtgctgcgcggggaggtcgacgcgcag
agcttcgagaagcacttcgagcccgccgcccggctgatcgccgacctcgtgctcggcgag
gagtacgtggacttcctcaccctcccggcctacgacctcatcgagggccggtga

DBGET integrated database retrieval system