KEGG   Kocuria flava: AS188_07440Help
Entry
AS188_07440       CDS       T04206                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kfv  Kocuria flava
Pathway
kfv00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AS188_07440
Enzymes [BR:kfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AS188_07440
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AS188_07440
    1.1.1.-  
     AS188_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AdoHcyase_NAD FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALU39612
UniProt: A0A0U3I8C8
Position
1654497..1655573
Genome map
AA seq 358 aa AA seqDB search
MRAARYYGRNDIRIDDLPEPEVGPGQVGIEVAWCGICGTDLHEYLEGPIFCPTPETPHPI
SGETAPVTLGHEFSGTVYAVGEGVDDLEVGRHVVVEPYIIHDDVDTGPESTDYHLSPDMG
FIGLSGRGGGLGEKIAVQRRWVHPIADSVPLDQAALIEPLSVGYHAVQRSGAKAGDVALV
GGAGPIGLLTSAVLKALGVTVVVSELSPLRRQKALEAGVADHALDPRETDVVAAVRELTG
GRGADVAFECTSVQVVLDTLMEALRPTGVLVVVSIWGHRSEFDMFTLVMKEIDVRGTIAY
VNSHPATIELVESGKIDLAPFITGRIGLEGLVEEGFDTLIHRNETAVKILVSPSGRGL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggcacggtactacggcaggaacgacatccggatcgacgacctccccgagccc
gaggtcggtccgggccaggtgggcatcgaggtggcctggtgcgggatctgcggcaccgac
ctgcacgagtacctcgagggcccgatcttctgcccgacccccgaaacgccccacccgatc
tcgggggagaccgctccggtgacgctggggcacgagttctccggcaccgtctacgccgtc
ggggagggcgtggacgacctggaggtgggccggcacgtcgtcgtcgagccctacatcatc
cacgacgacgtcgacaccggcccggagagcaccgactaccacctctcgccggacatgggc
ttcatcggcctctccggccgcggcggcgggctcggggagaagatcgccgtgcagcggcgc
tgggtccacccgatcgccgactccgtgccactggaccaggcggctctcatcgagccgctg
tcggtcggctaccacgcggtgcagcgctccggggcgaaggccggggacgtcgcgctcgtc
ggcggggccgggcccatcgggctgctgacctccgccgtgctgaaggccctgggcgtgacc
gtggtcgtctccgagctcagcccgctgcgccggcagaaggccctggaggccggcgtcgcc
gaccacgctctggacccgcgcgagacggacgtcgtcgcggccgtgcgcgagctcaccggc
ggccggggcgcggacgtggccttcgagtgcaccagcgtccaggtcgtgctcgacaccctc
atggaggcgctgcggcccaccggcgtgctggtcgtcgtctcgatctggggccaccgctcc
gagttcgacatgttcacgctcgtcatgaaggagatcgacgtgcgcgggaccatcgcctac
gtcaactcccacccggcgaccatcgagctcgtggagtccggcaagatcgacctcgccccg
ttcatcacggggcggatcgggctcgaggggctggtcgaagagggcttcgacaccctcatc
caccgcaacgagaccgcggtgaagatcctcgtctcgccctccggccgagggctctga

DBGET integrated database retrieval system