KEGG   Candidatus Kinetoplastibacterium galatii: ST1E_0185Help
Entry
ST1E_0185         CDS       T02466                                 

Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kga  Candidatus Kinetoplastibacterium galatii
Pathway
kga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ST1E_0185
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kga03011]
    ST1E_0185
Ribosome [BR:kga03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ST1E_0185
  Bacteria
    ST1E_0185
  Archaea
    ST1E_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGF49428
UniProt: M1LA90
Position
complement(793326..793655)
Genome map
AA seq 109 aa AA seqDB search
MITTAVIRGIHMSAQKVRLVADLIRNKSVAQAVNILTFSPKKAACVIKKAVESAIANAEH
NNGADVDELYVKEIFIDKAQSMKRFSARAKGRGNRIEKQTCHITVKVES
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgataactactgctgttatccgtggaattcatatgtcagctcaaaaggttcgattagtt
gctgatttaataagaaataaatctgttgcgcaagcggttaatatattaacgttttcgcct
aaaaaagctgcttgtgttattaaaaaagctgttgaatctgcaattgctaatgctgagcac
aataatggtgctgatgtagatgagttatatgttaaagaaatttttattgacaaggctcag
tctatgaaacgtttttctgctcgcgctaaaggtcgtggtaatcgcattgaaaaacaaact
tgtcatattaccgttaaggtagaatcctag

DBGET integrated database retrieval system