KEGG   Candidatus Kinetoplastibacterium galatii: ST1E_0334Help
Entry
ST1E_0334         CDS       T02466                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kga  Candidatus Kinetoplastibacterium galatii
Pathway
kga00450  Selenocompound metabolism
kga00970  Aminoacyl-tRNA biosynthesis
kga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ST1E_0334
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ST1E_0334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kga01007]
    ST1E_0334
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kga03016]
    ST1E_0334
Enzymes [BR:kga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ST1E_0334
Amino acid related enzymes [BR:kga01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ST1E_0334
Transfer RNA biogenesis [BR:kga03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ST1E_0334
 Prokaryotic type
   Other AARSs
    ST1E_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGF48807
UniProt: M1LTE7
Position
complement(88757..90820)
Genome map
AA seq 687 aa AA seqDB search
MHRTIFVTTALPYSNGSFHIGHIMEYIQADIWVRSMRMSGHKVYFVSADDAHGAPIMLKA
EAMGITPKELTNIYSKERPIYLNGFHIKFDHWHSTDSKENTLLSHQIYKKLKENNLIERR
IIQQLYDPVKQMFLADRYIKGTCPKCKSDNQYGDSCEECGSTYNPTELINPHSTITGAKP
LLRSSEHLFFKLSDSRCINFLRNWIETKNINNKKKLQDEVIAKISEWLGKDEKNSKLEDW
DISRDAPYFGIEIPDFKGKYFYVWLDAPIGYLSSLKSYCELQDINFEELLDKNNSVEQVH
FIGKDIIYFHTLFWPAMLHFSDRKTPDSVYVHGFVTIDGKKMSKSRGTGISPLKYLDLGL
NPEWLRYYFASKLNSRVEDIDINKGDFISKVNSDLIGKYINIASRTAPFITNFFDGKLNF
YNKNESLISEIKFKIDLISQLFENREYNKAIREVMSYADYTNQVFDISKPWEMAKKAKSG
DSSSMKDLHEICSFTIGRFKAISVMLAPILPETALYICLNFFQIEYPLNWNDALILPQKI
KPFKHMMSRIDEKIFSKLFEQNHKEKENMDLVTNKEFINIEDFARLDLVVAKIVRCENVE
QSDKLLRLTLDYGEENYKNVFSGIKKYYNPDDLIGKLVILVSNLKPRKMRFGISEGMVLA
ASSKDEISKEIYLIEPPEFTKPGMRIT
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgaactatctttgttaccacagcgcttccttactctaatgggtcatttcacatc
ggacacattatggagtatatacaggctgatatttgggttagatcaatgagaatgtctgga
cacaaggtgtactttgttagtgctgatgatgcccatggagctcctataatgcttaaagct
gaggcaatgggaataactcctaaagaactaacaaatatctatagcaaagaaagaccaatc
tatttaaatggctttcatataaaatttgatcactggcattcaactgattcaaaagaaaat
acattactatcgcatcaaatatacaaaaaacttaaagaaaataatcttatagaaagaaga
attattcaacaattatatgatccggtaaaacaaatgtttcttgctgaccgttatataaaa
ggaacatgcccaaagtgtaagtctgataatcagtatggtgattcttgtgaagaatgtggt
agcacatacaatcctactgaattaattaatccacattccacaataactggggcaaaacca
ttattaaggtcatctgaacatttgttttttaaattatctgactctagatgtataaatttt
ttaagaaactggatagaaactaagaacatcaacaataaaaagaaactacaagatgaagtt
atagcaaaaataagtgagtggttaggaaaagatgagaaaaattcgaaattagaggattgg
gacatatcaagagatgccccatatttcggtatagagattccagactttaaaggaaaatat
ttttatgtgtggttagatgcccctataggttatttgtcatctttaaaatcatactgtgaa
ttgcaagatataaacttcgaagaattgctagataaaaataattcagtagagcaagtacat
ttcataggcaaagatatcatttattttcacacattattctggcctgctatgctccacttt
tcagatagaaaaacaccagactctgtttatgtccatggctttgtaactatagatggaaaa
aaaatgtccaagagccgaggaactggaatatctccattaaaatatctagatcttgggtta
aatcctgaatggctaagatactatttcgcgtcaaaacttaactctagagtagaggacata
gatataaataagggtgattttatcagtaaagtaaatagtgatcttattggtaaatatata
aatattgcaagccggactgctccttttattaccaatttttttgatggaaaactgaatttt
tataataaaaacgaatcacttataagtgaaataaaatttaagatagatttaataagtcag
ttatttgaaaatcgcgaatataataaagcgataagagaagtaatgagctatgctgattat
acaaaccaagtatttgatatatcaaaaccttgggaaatggccaagaaagcaaaaagtggt
gattcttcttccatgaaagatcttcatgaaatttgctcatttacaattggcagatttaag
gcaatatctgtgatgctggctccaatcttgccagagactgcactatatatctgtttaaat
ttttttcaaattgaatatccattaaattggaatgatgccttaattttgccacaaaaaata
aaaccattcaaacatatgatgagtagaattgatgagaaaattttttctaagctgtttgaa
caaaaccataaagaaaaggaaaacatggatctagtaactaataaagaattcataaacata
gaagattttgcaagattagatcttgtggtagctaaaatcgtgagatgcgaaaatgtagaa
cagtctgataaattattaagattaacactggattacggggaagaaaattataaaaatgtt
ttttctggaattaagaaatattacaatccagatgatcttatcggaaaactagtaatctta
gtttctaatctaaaacctcgtaaaatgagatttgggatatcagaaggaatggtgttagct
gctagcagtaaggatgaaatatcaaaagaaatttacttgatagaacctccagagtttact
aaaccaggaatgagaataacttaa

DBGET integrated database retrieval system