KEGG   Candidatus Kinetoplastibacterium galatii: ST1E_0341Help
Entry
ST1E_0341         CDS       T02466                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
kga  Candidatus Kinetoplastibacterium galatii
Pathway
kga00670  One carbon pool by folate
kga00790  Folate biosynthesis
kga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ST1E_0341
   00670 One carbon pool by folate
    ST1E_0341
Enzymes [BR:kga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ST1E_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 Kelch_2 Kelch_6
Motif
Other DBs
NCBI-ProteinID: AGF48813
UniProt: M1L8B3
Position
complement(100349..100849)
Genome map
AA seq 166 aa AA seqDB search
MEIIIIVAYSDNRVIGKNNTLPWKLTSDLKSFKKHTINNTIIMGRKTWDSLPKKPLPDRE
NIVITRRNIIDCGALTAKSLSEAISLCSPGKKIFVIGGSSIYEQFLPIASRILATEIHSS
LNGDSFFPEIRSDIWLEIDRKPQIPENNYNYDFVTYIKQPKNLIVL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggaaataattattatagttgcctattctgacaacagagtaataggtaaaaacaataca
ctaccatggaaattaacaagtgatttgaaatcattcaaaaaacataccataaataacacc
attattatgggtagaaaaacttgggattcattacctaagaaaccattgcctgatagagaa
aatatcgttataacaagaagaaatataatagattgtggagctcttacagcaaaatctctt
agtgaagctataagtttatgttcacctggtaagaaaatttttgttataggaggatcttca
atatatgagcaatttctaccaatagcatcacgtatattagcaacagaaatacactcatcg
ctaaatggagattcttttttccctgagatacgttcagatatttggttagaaattgatcgc
aaaccacaaattcccgaaaataattataactacgattttgttacatatataaaacaacct
aaaaatcttattgttttataa

DBGET integrated database retrieval system