KEGG   Kangiella geojedonensis: TQ33_0420Help
Entry
TQ33_0420         CDS       T03889                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
kge  Kangiella geojedonensis
Brite
KEGG Orthology (KO) [BR:kge00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TQ33_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKE51406
UniProt: A0A0F6RBS6
Position
complement(443399..444676)
Genome map
AA seq 425 aa AA seqDB search
MDFLIANADTMIWIAVAFGFLMAFGIGANDVANAMGTSVGAKALTLKQAIIVAAIFEFAG
AYLAGGEVTKTIRKGMIDSSYFNGQPELLVFGMMAALLAAGIWLLIASKLGWPVSTTHSI
VGAIVGFAAVGVTTQAVNWGKVGSIVGSWVVTPVLAGVIAFLIVLSVQKLILNTENPFQK
AKRYVPVYMFLAGFVIALVTIMKGLKHVFKDKSIELSTLDIYLIAAGVGIIIAGVGAMFI
SRIKVDKKENKEYQFASVEKVFAVLMIVTACGMAFAHGSNDVANAIGPLAAIVSVIQSGG
EIGAKASVDPRILLVGAIGIVIGLIVLGSRVMATIGQKITHLTPSRGFAAELAAASTVII
ASGAGLPISTTQTLVGAVLGVGMARGIAALNLGVVRNIFVSWVVTLPAGAILSVIFFYIF
KAIFS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttaatagcaaatgcagacaccatgatttggattgccgtagcattcggcttc
ctcatggcattcggtatcggtgccaacgatgtggccaacgcgatgggtacttcggttggc
gctaaagcactgactctcaagcaagcgattattgttgcggcaatttttgaatttgcgggc
gcttatcttgccggtggcgaggtaacgaaaaccatccgtaaaggcatgatcgactccagc
tactttaatggtcagcctgaattattggtattcggtatgatggccgctttattggccgcg
ggtatatggctattaatagcttctaagctaggttggccagtctcaacgacccactctatt
gttggtgccatcgttggtttcgctgccgttggtgtgactacgcaagcggtcaactggggc
aaagtaggctcaatcgtagggagctgggtagtgactccggtgttagctggtgtgattgcg
ttcctcatcgtactcagtgtacaaaagctgattctaaacaccgaaaatcctttccaaaaa
gctaaacgttatgtgcctgtttacatgttcctggcaggctttgtcattgctttagttacc
atcatgaaaggcttgaagcacgtctttaaagacaaaagcattgagctaagcaccttagac
atctatttaatcgcagcaggcgtgggtatcattattgctggtgttggtgctatgtttatt
agccgtattaaagtcgataagaaagaaaacaaagaataccagttcgctagcgttgagaaa
gtgttcgcggtattaatgattgttaccgcttgtggtatggcatttgcacacggttctaac
gatgtcgccaatgcgattggcccactagcggcaattgtgagcgttattcagagtggtggt
gaaatcggtgctaaagcaagcgttgacccaagaatcttgttggttggtgcgattggtatc
gttattggcttgattgtattaggtagccgtgtgatggcgactattggtcaaaaaatcaca
cacttaacccctagccgaggcttcgccgcggaattagcagctgcttcaaccgttattatc
gccagtggtgcaggcctacctatctcgactacgcaaaccctagtgggtgcggttcttggt
gttggcatggcacgcggtatcgcagcattgaacttaggcgttgtgagaaatatctttgtt
tcttgggtagttaccttacctgccggtgccattttatcggttatcttcttctatattttc
aaggcgattttctcttaa

DBGET integrated database retrieval system