KEGG   Kangiella geojedonensis: TQ33_0931Help
Entry
TQ33_0931         CDS       T03889                                 

Definition
(GenBank) Maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
kge  Kangiella geojedonensis
Pathway
kge00350  Tyrosine metabolism
kge00643  Styrene degradation
kge01100  Metabolic pathways
kge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    TQ33_0931
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    TQ33_0931
Enzymes [BR:kge01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     TQ33_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C GST_C_5
Motif
Other DBs
NCBI-ProteinID: AKE51899
UniProt: A0A0F6TQ80
Position
1054567..1055217
Genome map
AA seq 216 aa AA seqDB search
MLKLYSYWRSTAAYRVRAALNIKRLSYSIIPIHLVKDGGEQHKPEYAEKNPQELVPLLDD
NGKLLSQSMAICEYIDEAYDGPKLLPSEPFLKAKVRSVCQVIACDIHPLDNLRVLQYLKG
ELQVSDEQKTTWYAHWILKGFAALEETLTEYKAQGPFCFGEDLTLADVFLVSQMYNARRF
DVDLSDFPRLVEIEKHCLTLDAFRNATPESQPDAVI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctttatagttactggcgctctacggcggcttaccgcgtaagagcagctctt
aatattaagcgtttgtcatattccattatacccatacatttggtcaaagatggtggcgaa
caacataaacccgaatatgctgaaaaaaacccacaggagctagtgccgttactagacgat
aatggcaagctcttgagccaatctatggctatctgtgagtacatagatgaagcctatgat
gggcctaaattacttcccagtgaacctttcctaaaggctaaagtcagaagtgtatgccag
gtcattgcttgtgatattcaccccctagataacttgcgagtattgcagtatttgaagggg
gagctacaagttagtgatgagcaaaaaacaacatggtatgcgcattggattctaaaagga
ttcgcagctcttgaagagacgttaactgaatacaaagcgcaagggcctttttgttttggc
gaagatttaacattggctgatgtgtttttggtgtcacaaatgtacaatgctcgacgattc
gatgttgatttatcggacttcccacgtttggtggagatcgaaaagcactgtttgactctg
gatgcttttagaaatgcgacccctgaatcgcagcctgacgctgttatttaa

DBGET integrated database retrieval system