KEGG   Kangiella geojedonensis: TQ33_1206Help
Entry
TQ33_1206         CDS       T03889                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kge  Kangiella geojedonensis
Pathway
kge00260  Glycine, serine and threonine metabolism
kge01100  Metabolic pathways
kge01110  Biosynthesis of secondary metabolites
kge01120  Microbial metabolism in diverse environments
kge01130  Biosynthesis of antibiotics
kge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TQ33_1206
Enzymes [BR:kge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TQ33_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP PALP Arg_repressor_C DinB_2
Motif
Other DBs
NCBI-ProteinID: AKE52165
UniProt: A0A0F6TQQ8
Position
complement(1369591..1370598)
Genome map
AA seq 335 aa AA seqDB search
MIDLRSDTVTQPTEAMRKVMAKAAVGDDVFHDDPTVNRLEALMAEMSGKADALFVPSGTM
SNLVGLLAHCQRGEEYIVGQDYHTYLYEAGGAPVLGSIVPQPVPVEPNGTLDLNKVAAVI
KKDDYHFARTKLLCLENTHNGKGIPLDYMQQAYDFAQSKGLGLHLDGARAFNATVALGCE
LTDLAQYADSVSICLSKGLGAPVGSVLCGDKDTIKWARRWRKMVGGGMRQAGVLAAAGIY
ALENHVERLAKDHAKAKILADRLEQYDALSVKPDLVQTNMVFIKTTADTAQGLANYLAQK
GVRIIAGETMRWVMHLDVTSEQLNYVCQQVEEYFS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgaagtgatactgtgactcaacccactgaagcaatgcgcaaagttatg
gctaaggccgcggttggcgatgacgtgtttcatgatgatcctacggtaaaccggttggag
gccttgatggcagaaatgtcaggaaaggctgatgccttgtttgttccttctggaaccatg
tcgaatttggttggtttgttagcgcactgtcaacgcggtgaagaatacatcgtagggcaa
gattatcacacctatctttatgaagcgggcggggcgccggtattaggtagcatagtgcct
caacccgttccagttgagcctaatggcactttggatttgaataaagtggccgctgttata
aaaaaagacgactatcacttcgcacgaaccaagctgttgtgtttagagaatacccataac
ggtaaagggatcccccttgactatatgcaacaagcatatgactttgctcagtcaaaaggg
ttaggcttacacctggatggtgctagagcctttaatgccacggtggctctcggctgtgag
ttaacagacttggctcaatacgctgactcagtttcaatatgcttatcaaagggcttaggt
gcaccagtgggctcagtattatgtggcgataaagataccattaagtgggcgcgtcgctgg
aggaaaatggtgggtggtggtatgcgtcaagcgggcgtgctggccgctgctggtatttat
gcgttagagaaccatgtggagcgccttgctaaagaccatgccaaagctaaaatattggcc
gatcgtttggagcaatatgatgctttatcggtaaagcctgatttggtacagactaatatg
gtctttattaaaactacagcagacactgcacaaggacttgcgaattacttagcacaaaag
ggcgtgcggattatagctggggaaacgatgcgctgggtaatgcacttagacgttaccagt
gaacaacttaattatgtctgtcagcaagtcgaagagtactttagttag

DBGET integrated database retrieval system