KEGG   Kangiella geojedonensis: TQ33_1248Help
Entry
TQ33_1248         CDS       T03889                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kge  Kangiella geojedonensis
Pathway
kge00071  Fatty acid degradation
kge00072  Synthesis and degradation of ketone bodies
kge00280  Valine, leucine and isoleucine degradation
kge00310  Lysine degradation
kge00362  Benzoate degradation
kge00380  Tryptophan metabolism
kge00620  Pyruvate metabolism
kge00630  Glyoxylate and dicarboxylate metabolism
kge00640  Propanoate metabolism
kge00650  Butanoate metabolism
kge00900  Terpenoid backbone biosynthesis
kge01100  Metabolic pathways
kge01110  Biosynthesis of secondary metabolites
kge01120  Microbial metabolism in diverse environments
kge01130  Biosynthesis of antibiotics
kge01200  Carbon metabolism
kge01212  Fatty acid metabolism
kge02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TQ33_1248
   00630 Glyoxylate and dicarboxylate metabolism
    TQ33_1248
   00640 Propanoate metabolism
    TQ33_1248
   00650 Butanoate metabolism
    TQ33_1248
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TQ33_1248
   00072 Synthesis and degradation of ketone bodies
    TQ33_1248
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TQ33_1248
   00310 Lysine degradation
    TQ33_1248
   00380 Tryptophan metabolism
    TQ33_1248
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TQ33_1248
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TQ33_1248
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TQ33_1248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kge04147]
    TQ33_1248
Enzymes [BR:kge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TQ33_1248
Exosome [BR:kge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TQ33_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: AKE52206
UniProt: A0A0F6RCP0
Position
1415785..1416963
Genome map
AA seq 392 aa AA seqDB search
MSDPIVIVSAARTPMGGFGGSLSTVKSTELGANAIAAAVERATLKPEDIQEVIMGCVLPA
GVGQAPARQATLGAGIPKTTGATTVNKVCGSGMKTIMLAHDLLVAGTNEVMVAGGMESMS
LAPYLLPTGRYGQRFGHGKTLDHMAFDGLEDAYEGQAMGVYAEQTVEKYGFTREDQDNFA
IESLARANKAIEDGSFKNEITPVTVKSRKGDVEVDTDEQPLKARPDKIPALRPAFKKDGT
VTAANASSISDGAAAVVMMRQSEAEKRGLKPLAKIHAHATNARTPAEFTIAPVGAMEKVL
EKAGWTKDDVDLFEINEAFAVVTMAAMKELELDHAKVNVHGGACALGHPIGCSGTRIVVT
LIEALRKYGKSKGVASLCIGGGEATALAIELV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcctatcgtaatagtctccgcagctagaacaccaatgggtggtttcggcggc
tctctttctactgttaaatcaacagaacttggcgctaacgcaatcgcagcagccgtagag
cgtgcgaccttaaagccagaagatatccaagaagttatcatgggttgtgttttacctgct
ggcgttggccaagctcctgctcgtcaagcgacacttggcgcaggcatccctaaaacaacc
ggtgccacaaccgtgaataaggtttgtggttcaggcatgaaaactatcatgttagctcac
gacttattagtcgctggcactaacgaggttatggttgctggtggtatggaaagcatgagc
ttagcgccttacctattacctacaggccgctatggtcaacgtttcggtcacggtaaaacc
cttgatcacatggcgtttgatggcctagaagatgcctacgaagggcaagcaatgggcgtt
tacgctgagcagacggttgagaaatacggctttactcgtgaagaccaagataacttcgct
atcgaatcactagctcgtgctaacaaagcgattgaagacggttcgttcaaaaacgaaatc
acaccggtaaccgttaagtcgcgcaaaggcgatgttgaagttgatactgatgagcagcct
ttaaaagcacgtccagacaagatccctgccctacgccctgcgttcaagaaagacggtacg
gtaacagcggcaaacgctagctctatttctgacggtgctgcagcagtagtcatgatgcgt
caatctgaggctgaaaaacgtggccttaagcctctggcaaaaattcatgcgcacgcgact
aacgctcgtaccccagcggaattcacaatcgctccagttggtgcaatggaaaaagttttg
gaaaaagctggctggacaaaagacgacgttgatttgtttgaaattaacgaagcctttgcc
gtggtcactatggcggcgatgaaagagctagagcttgaccatgcaaaagttaacgtccac
ggcggcgcttgtgcactgggccaccctatcggttgttctggtacgcgtatcgtggtgact
ttgattgaggcattacgtaaatatggtaagtctaaaggtgtggcgtcactgtgtattggc
ggcggcgaagcaacagcattagcgattgagctggtttaa

DBGET integrated database retrieval system