KEGG   Kangiella geojedonensis: TQ33_1293Help
Entry
TQ33_1293         CDS       T03889                                 

Definition
(GenBank) Methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
kge  Kangiella geojedonensis
Pathway
kge00670  One carbon pool by folate
kge01100  Metabolic pathways
kge01120  Microbial metabolism in diverse environments
kge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TQ33_1293
Enzymes [BR:kge01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     TQ33_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Protoglobin
Motif
Other DBs
NCBI-ProteinID: AKE52248
UniProt: A0A0F6RC95
Position
complement(1472061..1472999)
Genome map
AA seq 312 aa AA seqDB search
MSNPVITSNKAKPSYEEARIAEFLNQQIADLDGKVNVSFEFFPPNTPEMQKTLWSSIKKL
EPLSPDFVSVTYGAAASTRSRTHDVITKIIRETELTAVPHLTCIGSTEAEIESIAEDYWS
KGVRHIVALRGDLGQEAEQGDFKYATDLVYKLKQLHDFEISVAAYPEVHPEAETAKADLD
NLKRKVDAGASRAISQFFFSAEKFLRFRDQCQNHDLQIDLTPGILPVTNFTQLQKFAKFT
QVDIPDWMYKVYDGLQNDPETSRLIASHIAIEQVKLLVKEGVSDFHFYTLNRADLTYAIC
HSLGKRCLTPAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccagtgattacatcaaacaaagcaaaaccgtcttatgaagaagcgcgaatc
gctgaatttcttaatcaacaaatagcggatttggatgggaaagttaacgtttcttttgaa
ttcttccctcccaatacgcctgagatgcaaaagactttgtggtcgagcattaaaaagctt
gagccgttaagtcccgactttgtgtcggtaacctatggtgcggcagcaagtacacggtct
agaactcacgatgtgatcactaaaatcattcgagagaccgagctgacggctgtgccgcat
ctaacctgtattggttcaacagaagcagaaatcgaatccattgcagaagattattggtca
aaaggtgttcgtcatattgtggcgttacgcggcgatcttgggcaggaagctgagcaggga
gattttaagtatgctactgacttagtatataaactaaagcaactccatgattttgaaatt
agtgtcgccgcatatccagaggttcatcctgaggcagaaaccgctaaagctgacttagat
aacctgaagcggaaagtggacgctggtgccagtcgtgccattagtcaatttttctttagc
gcagaaaagttcttaaggtttcgtgaccaatgtcagaaccatgatttacagattgattta
acacctggaatcctgcccgtgactaacttcacgcagctacaaaagttcgctaagtttaca
caagtagatattcctgattggatgtataaagtttatgacggcttacaaaacgatcctgag
accagtcgtttaattgcctcacacattgccattgaacaggtcaagctactggttaaagag
ggcgttagcgattttcacttttataccttaaaccgtgctgatttaacttatgcaatttgt
catagcctaggcaaaaggtgcttaacacccgcagcttga

DBGET integrated database retrieval system