KEGG   Kluyvera georgiana: CEW81_02835Help
Entry
CEW81_02835       CDS       T04930                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
kgo  Kluyvera georgiana
Pathway
kgo00540  Lipopolysaccharide biosynthesis
kgo01100  Metabolic pathways
Module
kgo_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:kgo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CEW81_02835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kgo01005]
    CEW81_02835
Enzymes [BR:kgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     CEW81_02835
Lipopolysaccharide biosynthesis proteins [BR:kgo01005]
 Unusual sugar
  CEW81_02835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 HAD_2 Hydrolase S6PP
Motif
Other DBs
NCBI-ProteinID: ASG62639
UniProt: A0A248KGG3
Position
complement(547789..548355)
Genome map
AA seq 188 aa AA seqDB search
MSNAVASVATCYGPVSPQFIARAEKIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GVRCALTSGIEVAIITGRKAKLLEDRCATLGITHLYQGQSDKLIAYRELLAKLSLQPEEV
AYVGDDLIDWPVMAEIGLSVAVADAHPLLLPRADYVTRIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgctgtcgcatcggtcgccacctgttacgggccggtgagtccacaatttatc
gccagggcggagaaaatccgcctgttgatcctcgacgtcgacggagtgctgtccgacggc
ctgatttatatgggcaacaacggtgaagagctaaaggcctttaacgtgcgcgacggctac
ggcgtgcgctgcgccctcacctctggtatcgaagtagcgattattaccgggcgaaaagct
aaactgttagaagaccgctgcgctacgctgggtatcacgcatctctaccagggacagtcg
gataaacttatcgcctatcgtgaactgctggcgaagctgagcctacagccggaagaagtc
gcctacgtgggcgatgatctgatcgactggccggtgatggcagagatcggcttgagcgtc
gcggtggcggatgcgcacccgctgctgctgccgcgcgccgattacgtcacgcgcattgcg
ggcggacgcggtgcggtacgcgaagtctgcgacctgctgctgctggcgcaagggaagctc
gacgaagccaaagggcaatccatatga

DBGET integrated database retrieval system