KEGG   Kluyvera georgiana: CEW81_03945Help
Entry
CEW81_03945       CDS       T04930                                 

Definition
(GenBank) fimbrial protein
  KO
K07350  minor fimbrial subunit
Organism
kgo  Kluyvera georgiana
Brite
KEGG Orthology (KO) [BR:kgo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kgo02044]
    CEW81_03945
   02035 Bacterial motility proteins [BR:kgo02035]
    CEW81_03945
Secretion system [BR:kgo02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   CEW81_03945
Bacterial motility proteins [BR:kgo02035]
 Pilus system
  Fimbrial proteins
   CEW81_03945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FimH_man-bind
Motif
Other DBs
NCBI-ProteinID: ASG62756
UniProt: A0A248KHK6
Position
766785..767690
Genome map
AA seq 301 aa AA seqDB search
MKRVITVLTVLLMAGWSFNAWSFACRTASGTTIPIGGGSANVYVDLAPEVNVGQNLVVDL
STQIFCHNDYPETMTDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTTETARLIYNSK
TDKPWPTMLYLTPISSAGGVAISAGTLIAVLILRQTNNKNNDDFQFVWNIYANNNVVVPT
GGCDVSARDVTVTLPDYPGSTSIPLTVYCAQSQKLSYYLSGTTEDSANSIFTNTASASPA
SGVGVQLTRNGSVVPANSTVSLGTVSTSAVSLGLTANYARTHGQVTAGNVQSIIGVTFVY
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagtgataaccgtgttgacggtgctgctgatggccggttggtcgtttaatgcc
tggtcatttgcctgccggaccgccagcggaacgacgatccctatcggtggcggcagcgcg
aacgtgtatgtggatctggcgcctgaggtgaacgtggggcaaaacctggttgtcgatctt
tcgacgcagattttttgtcataacgattacccggagaccatgactgactacgttacgctg
caacgggggtcggcatacggtggcgtgttgtccagtttctccggtaccgtcaaatacaat
ggttccagctatccgtttcccaccaccacggagaccgcgcggctaatttacaactcgaaa
accgataaaccctggcccacgatgctctatctgacgccgattagctccgccggcggcgtg
gcaattagcgccggaacgcttattgccgttctgatccttcgccagaccaacaataaaaat
aacgacgatttccagtttgtctggaatatctacgccaacaacaatgtggtggtgcccacc
ggaggctgtgacgtctctgcgcgagacgtcacggtgacgctgccggattaccccggttca
acatccattccgctgacagtttactgtgcacagagtcaaaagctcagttactacctgtcg
ggtacgacggaggattcggcgaactccattttcaccaacaccgcatcggcttcgcccgca
agtggggttggcgtccagcttacccgtaacggtagcgttgtgcctgccaacagcacggta
tcgcttggcacggtaagcacctcggccgtgagccttggcttgaccgccaactatgcgcga
acccacggccaggtaacggcgggcaacgtacagtcgattattggcgtgacgtttgtttat
cagtga

DBGET integrated database retrieval system