KEGG   Kerstersia gyiorum: EHF36_02980Help
Entry
EHF36_02980       CDS       T05924                                 

Definition
(GenBank) response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
kgy  Kerstersia gyiorum
Pathway
kgy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kgy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EHF36_02980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kgy02022]
    EHF36_02980
Two-component system [BR:kgy02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   EHF36_02980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C AHJR-like OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: QBR39717
Position
complement(686008..686706)
Genome map
AA seq 232 aa AA seqDB search
MDKLPSKLLVVDDDPALRQLLAEYLNRHGYDTLLAPDATDLPARIARYSPDLIVLDRMLP
GGDGAQACRQLREQGEDIPIILLTARDETLDRISGLEAGADDYLGKPFDPRELLARIEAV
LRRKVGPSALNRTNPVNFGPFTYDPIRRQLFRDNEPMHLTGGEINLLEAFVNNPGKPLSR
EKLLALARDDDGERNDRAIDIAILRLRRVLEEDPKQPRWIQTVWGIGYRFAP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttcccagcaaactgctggtcgtcgatgacgaccctgccctgcgccagctt
cttgccgagtacctgaaccgccatggctacgacaccttgctggcacccgatgccaccgat
ctgccggcccgcatcgcgcgctactccccggacctgatcgtcctggaccgcatgctgccg
ggcggtgatggcgcccaggcctgccgccagttgcgggagcaaggagaagacattccgatt
atcctcctgaccgcccgcgacgaaaccctggaccgcatcagcggcctggaggctggcgcc
gacgactacctcggcaagcccttcgacccgcgtgaactgctggcgcgcatcgaggccgtg
ctacggcgcaaagtcggcccgtccgcactgaaccgcaccaacccggtcaacttcgggcct
ttcacctatgacccgatccggcgccaactgttccgcgacaacgaacccatgcacctgacc
ggcggtgaaatcaatctgctggaagccttcgtcaataaccccggcaagcccctgagccgg
gaaaaactgctggcgctggctcgcgatgacgacggcgaacgcaacgaccgcgccatagat
atcgccattctgcgcctgcgccgggtgctagaggaagaccccaagcaaccgcgctggatc
cagaccgtctggggcatcggctaccgcttcgctccctga

DBGET integrated database retrieval system