KEGG   Kerstersia gyiorum: EHF36_13615Help
Entry
EHF36_13615       CDS       T05924                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
kgy  Kerstersia gyiorum
Pathway
kgy00040  Pentose and glucuronate interconversions
kgy00053  Ascorbate and aldarate metabolism
kgy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EHF36_13615
   00053 Ascorbate and aldarate metabolism
    EHF36_13615
Enzymes [BR:kgy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     EHF36_13615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh RDM
Motif
Other DBs
NCBI-ProteinID: QBR41540
Position
3112218..3113738
Genome map
AA seq 506 aa AA seqDB search
MTFTPHGKHLIAGEWVATTDAFQSSPAHGPSYRFSTGSPELVDRACQAAEAAFPAYAASS
RQDRAALLEAIADEIEARGADITAIGSQETGLPEARLNGERCRTTGQLRLFARHILKGEY
LDRRLDEAQPERQPQARPEIRMMQRPVGPVAVFGASNFPLAFSVAGGDTAAALAAGCPVV
VKGHPAHPGTGEIVAQAILAAIQRTNMPPGIFSLIQDGGPATGAALVQHPLILAVGFTGS
QAGGRALFDLCAQRPEPIPFFGELGSVNPMFILPAALHARGAELAQGWAASLTLGAGQFC
TNPGIAIVSTGPQGDAFVNATASALANIGPQTMLTSGIADAYCHGKQRFEQHPAVREVYV
SGSSGRSASPNLYEVCAQDFLAAPTLAHEVFGPLGLVVRASNDQDMTRLARQLEGQLTAT
LQMDDDDTALAHALLPILERKAGRILVNGFPTGVEVVDSMVHGGPYPASTNFGATSVGTL
SIRRFLRPVAYQNLPGAIMPDDLRQF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgactttcaccccgcacggcaagcatctgatcgccggagaatgggtcgccaccactgac
gccttccagagcagcccggcccacggcccgtcgtaccgtttttccacaggctcgcctgaa
ctggtggaccgtgcctgccaggccgccgaagccgccttcccggcctatgcagccagcagc
cgccaggaccgggctgccctgctcgaagccatcgcagatgaaatcgaggctcgcggcgcc
gatatcacggccattggcagccaggaaaccgggctgcctgaagcccgcctcaatggcgaa
cgctgccgcaccaccggccagttgcgactgttcgcccggcacatactgaaaggcgaatac
ctggaccggcgcctcgatgaagcccaaccggaacgccaaccgcaagcacgccccgaaatt
cgcatgatgcaacgcccggtcgggcctgttgccgtgttcggagcctctaattttcccctc
gccttttccgtggccgggggcgacacggcggcagctctggcagcaggttgcccggtcgtg
gtcaagggccatcccgcccatcccggtaccggtgaaattgtcgcgcaggccatcctcgcc
gccattcagcgcaccaacatgccacccgggattttttcgctgatccaggacggcgggccg
gcgactggcgccgccctggtccagcacccgctgattcttgccgtcggattcaccggctca
caggcaggcggccgggcgctctttgatctctgcgcccagcgccccgaacccattccgttt
ttcggcgaactgggctccgtcaaccccatgttcatcctgcccgccgctctgcacgccagg
ggcgcagaactggcgcagggctgggcggcatccttgaccctgggagccggccagttttgc
accaaccccggcattgccatcgtcagcactggcccgcagggagatgcctttgtgaatgcc
acggccagcgccctggcgaatatcggcccccagaccatgctgaccagcggcattgccgat
gcctactgccacggcaagcagcgtttcgagcaacatcccgccgtgcgcgaggtctacgtc
agcggcagcagcgggcgcagcgccagcccgaacctctatgaggtctgcgcgcaggatttc
ctggctgcccccaccctggcgcatgaagttttcggccccctgggcctggtggtacgtgca
agcaacgaccaggacatgacacggctcgcccgccagctggaaggccagctgaccgccacg
ctgcagatggatgacgacgacacggcattggcgcacgcactactgcccatcctggagcgc
aaggccggccgcattttggtcaatggctttcctaccggcgtggaagtcgtcgacagcatg
gtgcatggcggcccctatcctgccagcaccaacttcggtgcaacatcggtaggcaccttg
tcgatacgccgcttcctgcgccctgtggcataccagaacctgcctggcgccatcatgccg
gatgacctgcgacagttctga

DBGET integrated database retrieval system