KEGG   Kluyvera intermedia: NCTC12125_02987Help
Entry
NCTC12125_02987   CDS       T06042                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
kie  Kluyvera intermedia
Brite
KEGG Orthology (KO) [BR:kie00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    NCTC12125_02987 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: VDZ84845
UniProt: A0A3S4FSE1
Position
1:2742162..2742539
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVQVQSVYIETHSMPEEERYVFAYTVTIRNLGRSAVQLLGRYWVITNGHGRET
EVQGEGVVGVQPHIEPGDEYQYTSGAVLETPLGTMQGHYDMVDVDGVPFAIDIPVFRLFV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattcgccacgagtttgcgtccaggttcagagcgtctacattgagacgcactct
atgccggaagaagaacgttatgtcttcgcctatacggtgaccattcgcaatctcgggcga
agcgcggttcagcttcttggccgttactgggttatcactaacggccacggccgtgaaacc
gaagtccagggggaaggtgtggtcggcgttcagccgcacattgaacccggcgatgaatat
cagtacaccagcggtgccgtgctggaaactccacttggcaccatgcaaggccactatgac
atggttgacgtcgacggtgtgccgttcgctatcgacattcctgtgttccgtcttttcgtt
cccacgctgatccattaa

DBGET integrated database retrieval system