KEGG   Kluyvera intermedia: NCTC12125_04246Help
Entry
NCTC12125_04246   CDS       T06042                                 

Gene name
ompR
Definition
(GenBank) Transcriptional regulatory protein OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
kie  Kluyvera intermedia
Pathway
kie02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kie00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCTC12125_04246 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kie02022]
    NCTC12125_04246 (ompR)
Two-component system [BR:kie02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   NCTC12125_04246 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: VDZ86031
UniProt: A0A1X0XB22
Position
1:3954106..3954825
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaattataagattctggttgtggatgacgacatgcgcctgcgcgcgctgctg
gagcgttacctgaccgagcagggcttccaggttcgaagtgtcgcgaatgccgaacagatg
gacagattgctgacacgtgagtctttccatctgatggtgctcgatttaatgctgcctggc
gaagatggtttgtctatttgccgccgcctgcgtagccaaagcaacccgatgccaatcatc
atggtgacggcgaaaggggaagaagttgaccgtatcgtcggcctggaaattggtgctgat
gactacattccgaaaccgttcaacccgcgtgaactgctggctcgtatccgtgcggtgctg
cgtcgtcaggcgaacgagttgccgggcgcgccttctcaggaagaggcagtgattgccttt
ggtaagttcaagctgaacctgggtacccgcgaaatgttccgtgaagatgagcctatgcca
ctgaccagcggtgagtttgctgttctgaaagcattggtgagtcatccacgtgagccgctg
tctcgtgacaagctgatgaacctggcgcgcggtcgcgagtactcggcgatggaacgttcc
atcgacgtacagatctcacgtctgcgtcgcatggtagaagaagatccggctcacccacgc
tacattcagaccgtttggggtctgggctatgtatttgtgccggacggttctaaagcatga

DBGET integrated database retrieval system