KEGG   Kluyvera intermedia: NCTC12125_04880Help
Entry
NCTC12125_04880   CDS       T06042                                 

Gene name
cobQ_3
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
kie  Kluyvera intermedia
Pathway
kie00860  Porphyrin and chlorophyll metabolism
kie01100  Metabolic pathways
Module
kie_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:kie00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCTC12125_04880 (cobQ_3)
Enzymes [BR:kie01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     NCTC12125_04880 (cobQ_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3
Motif
Other DBs
NCBI-ProteinID: VDZ86640
UniProt: A0A447MRQ4
Position
1:4543312..4543590
Genome map
AA seq 92 aa AA seqDB search
MQLCKNGQYSVDGAVSDDGQVFGTYLHGLFDSDAFTRALVNGLRERKGLAALDSDFHYAR
YKAQQFDILAESMRQHIDIEKIYTIMREHQEP
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttgtaaaaatggtcagtacagcgtggacggtgcggtgagtgatgatggccag
gtattcggtacctatcttcacggcctgtttgatagcgatgcgtttacccgtgcgctggtg
aacggactgcgtgaacgtaaaggactggcggcgctggacagtgactttcattacgcccgc
tacaaggcgcaacaatttgatattttggcggaatctatgcgtcagcatattgatattgaa
aagatttatacgattatgcgggaacatcaggagccgtga

DBGET integrated database retrieval system