KEGG   Kocuria indica: KocCE7_12340Help
Entry
KocCE7_12340      CDS       T05866                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
kii  Kocuria indica
Brite
KEGG Orthology (KO) [BR:kii00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    KocCE7_12340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QBJ22454
UniProt: A0A4P6RS49
Position
complement(2739552..2740778)
Genome map
AA seq 408 aa AA seqDB search
MTVELVILGLVVVTALAFDFTNGFHDTGNAMATSIATGALSPRTAVALSAVLNLVGAFLS
VEVATTVTKDVLLIQTSDGGLVHGLDPTLALVLIFSGLIGGILWNLATWLFGLPSSSSHA
LFGGLIGAGLASLGVAGVNWSGVVQKILVPAALAPFIAGCVAAVGTALVYLISRAASNRH
KDRGFRWGQVGTASMVSLAHGTGDAQKTMGVIALALIAHGNLSVQGIEDNGLPPWIIVTC
AVAIALGTYLGGWRVIRTLGKGLVEIEPPQGMAAEASSAAIILTSSHFGMALSTTHVATG
SILGSGVGKPGARVRWGVAGRMVVGWLLTLPAAAVVGAVCFIIARAVGGLSGAVVIFLLL
AVASAVIFARSRHQKVDRHNVNAEWDENTHSVAPGDPDRADTQEVARS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgaactggtgatcctgggcctggtggtcgtgaccgcactggctttcgacttc
accaacggattccacgacaccggcaacgccatggcaacatccatcgccaccggtgcgctc
tcacccaggacggcggttgcactgtccgcggtgctgaacctggtgggggcgttcctctcc
gtggaggtggccaccacggtgaccaaggacgtcctgctcatccagacctcggacggcgga
ctggttcacggactggaccccactctcgcgctggtgctgatcttctccggactcatcggc
ggcatcctctggaacctggccacctggctgttcggtctgccctccagctcgtcgcacgcg
ctgttcggcgggctgatcggcgccggcctggcctcgctcggcgtcgccggggtcaactgg
tccggtgtggtccagaaaatcctcgtccccgccgccctcgccccgttcatcgctgggtgc
gtggccgcggtggggacggcgctcgtctacctcatcagccgcgccgcctcgaaccgccac
aaggaccgcggcttccgctggggacaggtgggaacagcgtcgatggtgtctctcgcgcac
ggcacgggtgacgcgcagaagaccatgggcgtgattgccctcgccctgatcgcccacggg
aacctgagcgtccagggaatcgaggacaacgggctgccgccgtggatcatcgtcacgtgc
gccgtggccatcgcgctcggcacctacctgggcggctggcgcgtgatccgcaccctgggc
aagggactcgtggagatcgaaccgccgcagggcatggccgcggaggcttcctcggccgcg
atcatcctcacctccagccacttcggcatggcgctgtcgacgacgcacgtggccaccgga
tccatcctcggttcgggcgtcggcaagcccggggcacgggtgcgctggggcgtggccggg
cgcatggtggtgggctggctgctcaccctccccgccgcggccgtggtgggtgcggtgtgc
ttcatcatcgcccgggccgtgggcgggctgtccggcgccgtggtgatcttcctgctgctg
gcggtggcctccgccgtgatcttcgcgcggtcccggcaccagaaggtggaccggcacaac
gtcaatgccgagtgggacgagaacacccactccgtggcccccggtgacccggaccgggcc
gacacccaggaggtggctcgctcatga

DBGET integrated database retrieval system