KEGG   Kineobactrum salinum: G3T16_19105
Entry
G3T16_19105       CDS       T06468                                 

Definition
(GenBank) xanthine dehydrogenase family protein molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
kim  Kineobactrum salinum
Pathway
kim00230  Purine metabolism
kim01100  Metabolic pathways
kim01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kim00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    G3T16_19105
Enzymes [BR:kim01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     G3T16_19105
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QIB67201
UniProt: A0A6C0U515
Position
complement(4288720..4290939)
AA seq 739 aa
MTDTPPCPVMSVPRREAHQKVTGRAHYSSDILLPGQLYAGILRSPHARARVRQVDDCAVR
KVAGVRDVITPGDDPGFYWYGEQVPTLGEELRFVGDEIAALTADSEEAATDGLRAFAVDY
EVLEPVVGLDDAARDGAPLVYPDKPGNLAAKPRIYSRGDIKAGFAAAEVVVAGTWTTQTA
LHNALEPHGCNAWWDGELLNLWVSTQSIFTVRDNVASKLGLPLNRVRVHAQHIGGGFGAK
QVDWKPTVIAAILARRSNRPVKLMLDREAENLAAGNRNATRQQLRLGATRDGRLCAIAAT
IDIDGGAYTLGGENSMVAGCYQQLYDCDNVYTEQRQYYSNTGPAVAFRAPGYVEGTAALE
QAMDDLARELELDPFALRERNYSSRDQMRDKVYSSPEALRRCYSAARQDFDWPVRSQPAT
PRKCRGIGMAASVWPAGSRNPPAYATVIVQTDGSVSVLSGTQDIGTGTRTVLAQVAAQAL
DLPVDQVEVVIGDTATELYAPPSAGSATLATLGPAVHAAALEVRQQVLTLAAQELKAELQ
LLRLENGTVAGTAESPAVPLRELAGAAPPGSLRANSAIQSKPGAVATCTFAVQCAEVEVD
LDTAEITLLRLTCAPDCGAVVNRLLADSQVIGGVTQGLGFALTEARLVDDATGLVLNANL
EDYLVPTAADVPPINHAVVNLPDVSENPLGIKGLGEPPMIATAPAIANAVRDALGVRLRD
LPLTRRRLLEALKQSGTGR
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgactgatacgccgccgtgcccggtgatgtcggtacctcggcgggaagcccaccagaag
gtgaccggccgcgctcattacagcagcgacatcctgttgcccggacaactgtatgccggc
attttgcgcagtccccatgcccgggcacgggtccggcaggtggacgactgcgcggtgcgc
aaggtcgcgggcgtcagggacgtgatcacccctggcgatgaccccggcttttactggtat
ggcgagcaggtgcccactctgggcgaggagctgcggttcgtcggcgacgagatcgccgcg
ctcacggccgacagtgaggaagcggcgacggatggcctgcgcgcattcgcagtcgactac
gaggtgctggaacccgtggtcggtctcgatgacgccgcgcgcgacggtgcgccgctggtg
tacccggacaaacccggcaatctcgccgccaaaccacggatctactcccgcggtgacatc
aaggccggtttcgctgccgccgaggtggtggtggcgggaacctggaccacccagactgca
ctgcacaatgcgctggagccccatggctgcaacgcctggtgggatggcgaactgctcaat
ctctgggtatccacccagtcgatattcacagtgcgggacaacgtagcgagcaagttgggc
ctgccactgaaccgggtacgggtccacgcacaacacatcggcggcggcttcggcgccaag
caggtcgactggaagccaaccgtgatcgcagccattctcgcccgccgcagcaatcgtccg
gtgaagctgatgctggaccgcgaggcagagaatctggcggccggcaaccgcaacgcaacc
cgccagcagctcagactgggggcgacccgggatgggcggttgtgcgcgatcgcggcgacg
atcgatatcgacggcggcgcctataccctgggcggcgagaacagcatggtggccggctgc
tatcagcagctgtacgactgtgacaacgtatacacagaacagcggcagtactacagcaac
accggcccggccgtagcctttcgcgcaccgggctatgtcgaggggaccgctgccctggag
caggcgatggatgacctggcccgcgagctggagctcgatcccttcgccctgcgtgagcgc
aattacagctcccgcgaccagatgcgcgacaaggtgtattcctctcccgaggcgctgcgg
cgctgctacagcgcagcgcggcaagacttcgattggccggtgcggtcacagcccgccaca
ccgcgcaagtgccgcggtatcggtatggccgccagtgtatggccggcaggcagcaggaac
ccgcctgcatatgccaccgtcatcgtccagacggacggttcagtcagtgtgcttagcggc
acccaggacatcggtacgggtacccgtactgtgctggcgcaggtcgccgcccaggcgctg
gatctgcccgtcgatcaggtagaggttgtgatcggcgatacggcgaccgaactgtatgca
ccgcccagcgccggcagcgcgaccctggccacgctggggcccgccgtgcacgcagcggcc
ctggaggtccggcaacaggtgctgacactcgccgcgcaagagctgaaggccgagctgcag
ctactgcgactggaaaatggtaccgtcgccggcacggccgagagtcccgctgttccgctt
cgggaactggctggcgcggctcccccgggatcacttcgggccaacagtgcaatccagagc
aaacccggtgcggtcgctacctgtacgttcgcggtgcaatgcgcggaagtggaagtggat
ctggataccgcggagatcacgctgctgaggttaacatgtgcaccggactgcggcgccgtc
gtcaatcgcctgctggccgacagccaggtcatcggcggtgtcacccagggcctgggattt
gccctgaccgaagcacggctggtcgacgatgccaccggcctggtgctcaatgccaacctg
gaggactatctcgttcccaccgcagctgacgtaccacctatcaaccatgcagtcgtcaat
ttgccggacgtttccgaaaacccgctgggcatcaaggggctcggggagccacccatgatt
gcgacggcgccggcgatagccaatgcggtcagggacgcgttgggtgtgcggttgcgagac
ttgccactgacgcgccggcgcctgctggaagcactgaaacagtcggggacgggacgatga

DBGET integrated database retrieval system