KEGG   Phytobacter ursingii: AB182_04355Help
Entry
AB182_04355       CDS       T03950                                 

Gene name
recD
Definition
(GenBank) exonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
kin  Phytobacter ursingii
Pathway
kin03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kin00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB182_04355 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kin03400]
    AB182_04355 (recD)
Enzymes [BR:kin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AB182_04355 (recD)
DNA repair and recombination proteins [BR:kin03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB182_04355 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 SH3_13 UvrD-helicase DUF2075 AAA_22 PhoH UvrD_C AAA_16 MukB AAA_28 CbiA T2SSE SRP54 FtsK_SpoIIIE Bcl-2 TrwB_AAD_bind NTPase_1 NACHT AAA
Motif
Other DBs
NCBI-ProteinID: AKL10602
UniProt: A0A0G3Q9A0
Position
196461..198293
Genome map
AA seq 610 aa AA seqDB search
MKLRTLLQQAAALKILRPLDVQFALTVASDDEPAVMLAAAMLSFDAGEGHVCLPLSRLAP
ENLPARAHPLLASLYEEVGHPADWRKTLLASPAVSEGEAATPMILVGERLYLNRMWCNEC
SIAAFFAKVNHPLAVDENRLRQALDNLFQPSDDINWQKVAAAVALTRRVSVISGGPGTGK
TTTVAKLLAALVQMADGSRCRICLAAPTGKAAARLTESLGAALRQLPLTDKQKATLPDEA
STLHRLLGALPGSQRLRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPQHARVIFLGD
RDQLASVEAGAVLGDICAWVNKGFTPERAAQLSRITGTTVPAGEGASASALRDSLCLLQK
SYRFGSDSGIGQLAAAVNRGDKAAASAVLGQGFSDIENKHLQSTEDYQSMIDDALAGYGR
FLGLVRDGAQPQEVLTAFGEYQLLCALREGPFGVSGLNDRIEQALIRQRRISRPAHARWY
HGRPVMITRNDASLGLFNGDIGIALDQGQGIRVWFPLPDGSLKSVQPSRLPEHDTAWAMT
VHKSQGSEFDHAALILPGQIVPVVTRELVYTAITRAKKRLSLYADERILAQAIATRTERR
SGLNAIFETM
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgtacgttattgcagcaggccgcagcgctaaaaatattacgccctctggat
gtgcagttcgccctgaccgtggccagcgatgatgaacctgcggtgatgctggcggcggcg
atgctgagctttgacgccggagaagggcatgtctgcttaccgctttcccgtttagcgccg
gaaaacctgcctgccagagcgcatccgttactggcctctctttatgaagaggttggtcat
cctgcggactggcgaaagacgttactggcctcgcctgccgttagtgagggggaggcggca
acgccgatgatcctcgtgggtgagcggctctacctcaatcgtatgtggtgcaatgaatgc
agtattgccgccttttttgctaaggttaatcaccccctggcggtagatgaaaaccgcttg
cggcaggcgctggataacctgtttcaaccttcggatgatatcaactggcagaaggtggcg
gcggcggttgcgctgactcgccgcgtgtcggtgatttctggtgggccgggtaccgggaaa
accacgacggtggcgaagctgcttgccgcgctggtgcaaatggccgatggttcacgctgt
cgcatttgtcttgccgcaccaacagggaaggcagccgctcgtctgacggaatcattaggt
gcagcgcttcgtcagttgccgttgactgacaaacaaaaggcgacgctgcctgacgaagcc
agtaccctgcatcgtcttctgggcgcgctacccggtagccagcgcctgcgttatcacgcg
ggcaatccgttgcatctggatgtgctggtggtggatgaagcctccatgattgacctgccg
atgatgtcacggctgattgatgcactaccgcaacatgcgcgggtcattttcctcggagac
cgcgaccagttagcctcagtggaggccggggcggtactcggagatatttgcgcctgggtc
aataaagggtttactccggagcgcgctgcacagttgtcgcgaataacaggaacgaccgta
cccgctggagaaggcgcttcggccagtgcgctacgtgacagcctgtgcctgctgcaaaaa
agctatcgctttggcagcgattcgggcatcgggcaactggcggcggcggttaatcgtggc
gataaagcggcggcaagcgcggtgctgggccagggctttagcgatatcgaaaataaacac
ctgcaaagtacagaagattatcagagcatgattgatgatgcgctggcaggctatggacgt
tttctcgggctggttcgcgatggcgcgcagccgcaagaggtccttaccgcttttggtgaa
tatcagttgctgtgtgcgttgcgtgaagggccatttggcgtaagtgggctgaacgatcgt
atcgagcaggcgctgattcggcagcggcggatttcacgcccggcgcatgcgcgctggtat
cacggcaggccggtcatgatcacgcgtaatgatgcatcgctggggctgtttaatggcgat
attggtattgcgctcgatcaggggcagggcatccgtgtctggttcccgttacctgacggc
agcctgaaatccgtacagcccagccgcttaccggagcatgacaccgcctgggcgatgacg
gtacataaatcgcagggatcggagtttgatcatgcggccctgattttgccgggccagatt
gtgccagtggtgacaagagaactggtctataccgcgattacccgtgcgaaaaagcggctc
tcgctgtatgccgatgaacgtattctggcgcaggccattgccacgcgtaccgaacggcga
agcggactgaatgccatttttgaaacgatgtag

DBGET integrated database retrieval system