KEGG   Phytobacter ursingii: AB182_04460Help
Entry
AB182_04460       CDS       T03950                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kin  Phytobacter ursingii
Brite
KEGG Orthology (KO) [BR:kin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kin03016]
    AB182_04460
Enzymes [BR:kin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AB182_04460
Transfer RNA biogenesis [BR:kin03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AB182_04460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AKL10618
UniProt: A0A0G3Q7E7
Position
217040..217822
Genome map
AA seq 260 aa AA seqDB search
MLEIIYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMDEAVLDYPLVEELDKIADKFAREDK
GPQPALTHYRGMATTEMPVATSKFPTTRYGLVELLPQTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFGCNRLMLHASQLTLTHPFTGEPLTLHAGLDDVWMRALSQFGWQGLL
PDNERVEFVSPCGQDGEIHI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaattatctatcaggacgaatggctggttgcggtgaataaaccgtcaggctgg
ctggtacaccgaagctggctcgatcgtgatgaaaaagtggtggtgatgcaaaccgtccgc
gaccagattggtcagcatgtttttactgcgcatcgtctcgacagacccacctccggcgta
ctgctgatggggttatcgagtgaggcgggacgccttctggcgcagcaatttgagcagcac
caaatacagaagcgttaccacgccattgtgcgcggctggctgatggatgaagcggtactg
gattatccgctggttgaagaactggataaaatcgcagacaaatttgcccgcgaagataaa
ggcccgcagccagcattgacgcactatcggggtatggcgacgactgaaatgccggtggcg
accagtaaatttcctaccacgcgttacggccttgtcgaactgcttccacaaaccgggcgt
aagcaccagctccgtcgccatctcgcccatttacgccacccgattatcggtgacagtaaa
cacggcgatttgcgtcagaaccgcagcgcggcagagcattttggctgtaaccgtctgatg
ctccatgccagtcagttaacgctcactcacccgtttactggcgaaccgctgaccctacat
gccgggctggatgatgtctggatgcgggcgttgtcgcaatttggctggcagggacttctc
cctgataatgaaagggttgagtttgtctcgccgtgcggtcaggatggcgagattcacatt
taa

DBGET integrated database retrieval system