KEGG   Phytobacter ursingii: AB182_07185Help
Entry
AB182_07185       CDS       T03950                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
kin  Phytobacter ursingii
Pathway
kin00020  Citrate cycle (TCA cycle)
kin00620  Pyruvate metabolism
kin01100  Metabolic pathways
kin01110  Biosynthesis of secondary metabolites
kin01120  Microbial metabolism in diverse environments
kin01130  Biosynthesis of antibiotics
kin01200  Carbon metabolism
Module
kin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB182_07185
   00620 Pyruvate metabolism
    AB182_07185
Enzymes [BR:kin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AB182_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO DUF3322
Motif
Other DBs
NCBI-ProteinID: AKL11105
UniProt: A0A0G3Q787
Position
810333..811991
Genome map
AA seq 552 aa AA seqDB search
MKRMTARLFSMAVGLNAVSAAAKANASKEQETDVLLIGGGIMSATLGTYLQELEPNWSIT
MVERLDALAEESSNGWNNAGTGHAALMELNYTPQNQDGSISIKKAIEINEAFRISRQFWA
HQVETGVLSEPRSFINTVPHMSLVWGDDNVNFLRARYKALQQSTLFRGMRYTENHEQIRA
WAPLVMEGRDPQQKVAATRTEIGTDVNFGEITRQLIHSLQRKDNFSLKLGSEVRSIKRNA
DNTWNVTIASLKNSGVDQVIKAKFIFIGAGGAALKLLQESGIPEAAEYAGFPVGGQFLVS
ENPDVVNSHLAKVYGQATVGAPPMSVPHIDTRIIDGKRVLLFGPFATFSTRFLKNGSLWD
LLRSTNSSNFLPMLSVGMTNFSLVKYLMNQVLQNDDDRFDALCEYYPLAKKEDWRLWQAG
QRVQIIKRNAKKLGELRLGTEVVSDKEGTIAALLGASPGASTAAPIMLELMQKVFPEKVA
SPEWQAKLKEIIPFLGVKLDGNVEASDEELHYTSRVLGLKCDESPLADATPPVRKPSHVV
PAENEPAADIAL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatgactgccagactgttttcgatggctgtcgggcttaatgctgtctctgcg
gcagcaaaagctaacgcatcgaaagagcaggaaacggatgtgcttttaatcggtggtggg
atcatgagcgccacgttgggaacctacctccaggagctggagcccaactggtcgatcacc
atggtggaacggctggacgcgctggcggaagagagctccaacggctggaacaatgccggt
acggggcacgccgcattgatggaactgaactacaccccgcaaaaccaggatggatcaatc
agtatcaaaaaggcgattgagattaacgaagcgtttcgtatctctcgtcagttctgggcg
catcaggtggaaaccggtgtgctgagcgaaccgcgctcgtttattaataccgttccgcac
atgagtctggtgtggggcgatgacaacgttaacttcttgcgtgctcgctacaaagcgttg
cagcaaagtacgttattccgtggcatgcgctatacggaaaaccacgagcagatccgcgca
tgggcgccgctggtcatggaagggcgcgacccgcagcagaaagtggcggcgacgcgtacg
gaaatcggtaccgatgtaaatttcggcgagattacccgtcagctgattcattccttacag
cgcaaagacaacttctccctcaagttgggtagcgaagttcgtagcatcaaacgcaatgca
gataacacctggaatgtgaccatcgccagcctgaaaaacagcggcgtcgatcaggtcatc
aaggccaaatttatctttattggcgccggtggcgccgcgctgaaactgttgcaggaatcc
ggtatcccggaagcggcggaatacgcgggcttcccggtcggcggtcagttcctggtgtcc
gaaaatccggatgtggtgaacagccatctggcgaaggtgtatggtcaggcgaccgtgggc
gcgccgcccatgtctgtaccgcatattgatacccgtattattgatggcaagcgcgtgctg
ctgtttgggccgttcgccaccttctcaacgcgctttttgaaaaatggctcgctgtgggat
ctgctgcgctcaaccaacagttctaacttcctgcccatgttaagcgtcgggatgaccaat
ttcagcctggtgaaatacctgatgaatcaggtgctacaaaatgacgacgatcgctttgat
gccctgtgcgagtactatccgctggctaaaaaagaggactggcgtttatggcaggccggg
caacgcgtacagatcatcaaacgcaatgcgaagaagctgggtgagctgcgtctgggcacc
gaagtggtgagtgacaaagagggcaccattgctgcgctgttgggcgcatcgccgggcgct
tccaccgccgcgccgatcatgctggaactgatgcagaaagttttcccggaaaaagttgca
tcccctgagtggcaggcgaaactgaaagagatcatcccgttcctgggcgtgaagcttgat
ggcaacgttgaagcgtcggatgaagagttgcattacaccagccgcgtgctgggtctgaaa
tgcgacgagtcgccgctggcagacgccacgccgccggtacgaaaaccctcgcatgttgtg
cctgcggagaatgaacccgcggcagatatcgcgctgtaa

DBGET integrated database retrieval system