KEGG   Kluyvera intermedia: AB182_12030Help
Entry
AB182_12030       CDS       T03950                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kin  Kluyvera intermedia
Pathway
kin00071  Fatty acid degradation
kin00072  Synthesis and degradation of ketone bodies
kin00280  Valine, leucine and isoleucine degradation
kin00310  Lysine degradation
kin00362  Benzoate degradation
kin00380  Tryptophan metabolism
kin00620  Pyruvate metabolism
kin00630  Glyoxylate and dicarboxylate metabolism
kin00640  Propanoate metabolism
kin00650  Butanoate metabolism
kin00900  Terpenoid backbone biosynthesis
kin01100  Metabolic pathways
kin01110  Biosynthesis of secondary metabolites
kin01120  Microbial metabolism in diverse environments
kin01130  Biosynthesis of antibiotics
kin01200  Carbon metabolism
kin01212  Fatty acid metabolism
kin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB182_12030
   00630 Glyoxylate and dicarboxylate metabolism
    AB182_12030
   00640 Propanoate metabolism
    AB182_12030
   00650 Butanoate metabolism
    AB182_12030
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB182_12030
   00072 Synthesis and degradation of ketone bodies
    AB182_12030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB182_12030
   00310 Lysine degradation
    AB182_12030
   00380 Tryptophan metabolism
    AB182_12030
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB182_12030
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB182_12030
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB182_12030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kin04147]
    AB182_12030
Enzymes [BR:kin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AB182_12030
Exosome [BR:kin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB182_12030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKL11993
UniProt: A0A0G3QBA2
Position
complement(1793715..1794896)
Genome map
AA seq 393 aa AA seqDB search
MQDVVIIAATRTPTGNFHGALTPLSAVELGVCAVKALLEKSGVRPEQVDEVIIGQVLSAG
CGQNPARQTALHAGIPVTTPAVTVNQVCGSGLKAVLLAVQTIRSGDAHIVIAGGQESMSN
APYLVDGARAGLRLGHSNMLDSVIHDGLWDAFNDYHMGITAENLAEKYAIDRARQDAFAL
ASQQKAVAAREAGRFNAEITPVSVPRARKEPLIVSQDEPPRPETSLELLHRLRPAFRPEG
GTVTAGNASSLNDGAAAVLVMSAEKARELNLTPMARIAGYAVAGVDPAVMGLGPVPATRE
ALKRAGWAINELDLIEANEAFAVQALAVGDELGWNSERVNVNGGAIALGHPIGASGCRIL
VTLLHEMQRRDAHKGLATLCVGGGQGVALAVSR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgtggtgattatcgcagcaacccgcacgccgaccggtaattttcatggcgct
ctgaccccgctgtcagcggttgagcttggcgtctgcgcagtgaaagcgttgctggaaaag
agcggggttcgtcccgaacaggtagacgaggtgattattggccaggtattaagcgcgggc
tgtggtcagaacccggcgcgtcagacggcgctgcatgcggggatcccggtgacgacgcca
gcggtgacagtcaatcaggtgtgcggttccggcctgaaagcggtgttgctggcggtccag
acgatccgcagcggcgacgcgcacatcgtgatcgctggcggtcaggagagcatgagcaac
gccccctatcttgtggacggggcacgcgccggattacgcctcggccatagcaatatgctt
gatagcgttattcacgacgggctatgggacgcgttcaacgactatcacatggggatcacg
gcagaaaacctggcagagaaatacgcgattgaccgtgcgcgccaggatgcctttgccctt
gcctcacagcagaaagccgttgcggcccgcgaggccgggcgtttcaacgcagaaataacc
cccgtcagcgttccgcgtgccagaaaagagccactgatcgtcagtcaggatgagccgccc
cgcccggaaacctcgctggaattattacaccgtctgcgccctgcgtttcgccccgagggc
ggtacggtgacagcgggcaacgcgtcatctttgaatgacggcgccgcggcagtgctggtc
atgagcgcggagaaagcccgggaactgaaccttaccccaatggcccgcattgccgggtat
gcggtggcgggcgttgatccggcggtcatggggcttgggccggtcccggcaacgcgtgaa
gccctgaaacgcgcaggctgggctatcaacgaacttgatctgattgaagctaacgaagca
tttgctgtccaggcgctggcggtgggcgacgaactgggctggaacagcgagcgcgtcaat
gtgaatggcggcgctatcgccctcggtcatcccattggcgcctcggggtgtcgcatcctg
gtgacactcctgcacgaaatgcagcgccgggacgcgcataaagggctggcgacgctctgc
gtcggcggcggtcagggcgtcgcactggcggtatcccgatga

DBGET integrated database retrieval system