KEGG   Kluyvera intermedia: AB182_13645Help
Entry
AB182_13645       CDS       T03950                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kin  Kluyvera intermedia
Pathway
kin00052  Galactose metabolism
kin00500  Starch and sucrose metabolism
kin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AB182_13645
   00500 Starch and sucrose metabolism
    AB182_13645
Enzymes [BR:kin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AB182_13645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AKL12289
UniProt: A0A0G3Q8R6
Position
2158242..2159966
Genome map
AA seq 574 aa AA seqDB search
MKKLTLPVTSGMKFDIWLKRSRENSSPLLQFSAGGEIIYAIKKAADYHQYFTYTHYSDQP
LTIEWDEDAADISLFYYWLSETLAQEGVTFLISDTHTLYPVGRSKMVDWYSKESLRPALH
FSPFINWMNDPNGLCKIDETYHLFYQYYPHSTEWGPMHWGHAASEDLYHWRHYPVFLQPE
QNLEALGATGGAFSGTAFQERDGKLRFWFTERLPAYDLYKGYREVQKCATPGPWLDKVES
VKQVLSELPAGVGCDFRDPKVWFDGEKNHYFMLLGASVDGDPAALLFTSEDSDEWTFDHV
LWRADSHFREHGGRCVECPDFFSINGKWVLIIGIVGYTEPQTGRHNLLYAQTGDFNSGRF
TPDDKPLQTLDFGTDFYALQTFRDGQQILGFAWLYNWASKKSAASVYSGEMSLPRRFMLN
NHGALCMQPLLPPEACVRQRTDHHQACQNGLLHLSVDRQQSFSLKLTGEDISRLLLTLNG
ETGEQAELCYAENWLTLRAECHDEGQYGAYVEKIETLELFFDAGIVEVFANEGSHCGTRR
YFHLSYCNELTLKYNSSAQITTARLTQYRSIWEQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaacattacctgttacttcaggcatgaagtttgatatttggctgaaacgc
agccgtgaaaacagctcgcctctattacagttttcagcaggaggggaaattatctacgcg
ataaaaaaggccgctgactatcatcaatatttcacctatacccattattccgatcagccg
ttaaccattgaatgggatgaggatgcagcggatatatctctgttttattactggctgtcg
gaaacattagcgcaggaaggcgttacctttttgatcagtgatacacatacgctttacccg
gttggacgcagcaagatggtggactggtattcgaaggaatcgctacgtccggcgctgcat
ttttccccgtttataaactggatgaacgaccctaacggactatgcaaaatcgacgagacc
tatcatctcttctatcagtattatccgcacagcactgaatggggaccaatgcactggggg
catgccgccagtgaggatctttaccactggcgacactaccctgtctttctacaaccggag
caaaacctcgaggcgctgggcgcgactggcggtgcattttccggcaccgcttttcaggaa
cgcgacggtaaacttcggttctggtttacagaacgtctgccagcgtacgatctttataag
ggctatcgtgaagtgcagaagtgcgctacaccgggtccttggctggataaagttgaatca
gtaaagcaggtcttgagcgagctgccagcaggcgtaggttgtgatttccgcgatccgaag
gtctggttcgatggtgaaaaaaaccactattttatgctacttggcgcgtcagtggatggc
gatccggcagcactgctgttcacttcggaagacagtgatgagtggacattcgaccacgtg
ctatggcgagcggatagccacttcagggaacacggtggacgttgtgtcgaatgcccggat
tttttctctatcaacgggaaatgggtattaatcatcggtatcgtcggctataccgagcca
caaaccggccgtcataacttgctctatgcccagaccggagacttcaacagcggtcgcttt
acacctgatgataagcctttgcagacactggatttcggcaccgatttttatgccttacaa
acttttcgcgacgggcagcagatactgggtttcgcctggctctataactgggccagcaaa
aaaagcgctgcgtcagtctacagcggtgaaatgtctttgccgcgccgctttatgctcaat
aaccatggggctctgtgcatgcagccgttgctaccgccagaagcatgcgttagacagcga
actgaccatcatcaggcatgccaaaatggattgctgcatctgtctgtcgataggcagcag
tcgttttcactgaagctgaccggtgaggacatatcccggctgcttttgacactgaacggg
gaaacaggcgaacaagcagaactgtgttacgccgaaaattggcttacgcttcgggccgaa
tgtcatgacgaagggcagtatggcgcttacgttgaaaagatcgagacgcttgagctgttt
ttcgacgctggcattgtcgaggtttttgccaacgagggaagccattgtggcacaaggcgt
tacttccatctcagttactgtaatgagcttacgctgaaatacaattcatcagcacagata
accacggcacgactgactcaataccgtagcatttgggaacaataa

DBGET integrated database retrieval system