KEGG   Phytobacter ursingii: AB182_23670Help
Entry
AB182_23670       CDS       T03950                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
kin  Phytobacter ursingii
Pathway
kin00270  Cysteine and methionine metabolism
kin00920  Sulfur metabolism
kin01100  Metabolic pathways
kin01110  Biosynthesis of secondary metabolites
kin01130  Biosynthesis of antibiotics
kin01230  Biosynthesis of amino acids
Module
kin_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:kin00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AB182_23670
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AB182_23670
Enzymes [BR:kin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AB182_23670
    2.3.1.46  homoserine O-succinyltransferase
     AB182_23670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AKL14107
UniProt: A0A0G3QJ77
Position
complement(4268085..4269014)
Genome map
AA seq 309 aa AA seqDB search
MPIRVQDELPAVNFLRDENVFVMTTSRATGQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQVDIKLLRIDARESRNTPTEHLNNFYCNFDEISEENFDGLIVTGAPLGLVEFNDVAY
WPQIKQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTRSEKLSGVYEHHILHPHALLT
RGFDDTFLAPHSRYADFPAALIRDYTDLEILAETEQGDAYLFASKDKRIAFVTGHPEYDA
NTLAGEYFRDVEAGLSPDIPYNYFPKNDPRNKPHATWRSHGNLLFTNWLNYYVYQITPFD
LSHMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcgggtgcaggacgagctaccagccgtcaatttcttgcgtgatgaaaatgtc
tttgtgatgacgacatcgcgtgctacaggtcaggaaattcgtccgctcaaggtgcttatc
ctcaacctgatgccaaagaagatagagacagagaaccaatttttgcggttactctccaac
tcgccactgcaggtggatatcaagttactgcgtattgacgcccgtgaatcacgcaatacg
ccgacggaacatctcaacaacttctactgcaactttgatgaaatcagcgaagagaatttc
gatggtttgatcgtaaccggtgcgcccctgggtctggtcgaatttaacgacgttgcctac
tggccgcagatcaaacaggtactggagtgggcaaaagatcatgtcacctccacgctattt
gtctgttgggcggtacaagccgcactcaacatcctttacggtatcccgaagcaaacccgc
agtgaaaagctgtccggtgtctacgagcatcacattttgcatccacatgccctgctgacg
cgtggttttgatgatactttcctcgcgccgcactcacgctatgctgatttcccggcggca
ctgattcgtgactataccgacctggaaattctggctgagaccgagcagggcgatgcctat
ctgtttgccagtaaagataagcgtatcgcctttgttactggtcatcctgagtacgacgcc
aataccctggcgggggaatatttccgtgatgttgaggccgggctgtcaccggacatcccg
tataactatttcccgaaaaatgatccccggaacaagccacatgcgacatggcgtagtcat
ggcaatctgctatttaccaactggctgaactactacgtttaccagattacgccgttcgat
ctgagccacatgaacccaacgctggattaa

DBGET integrated database retrieval system